SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011521 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011521
Domain Number 1 Region: 950-1072
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-26
Family Ankyrin repeat 0.000000241
Further Details:      
 
Domain Number 2 Region: 33-114
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.3e-23
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 1081-1139
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-17
Family SH3-domain 0.0000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011521   Gene: ENSAPLG00000011682   Transcript: ENSAPLT00000012250
Sequence length 1148
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742799.1:507191:534509:-1 gene:ENSAPLG00000011682 transcript:ENSAPLT00000012250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDPSTAVKRKPSQLVFLRNFLMNPQYFSNIIEMFLTVYLSNNEQHFTEVPVTPETTCRDV
VELCKEPGESECHLAEVWCGSERPIADNERMLDILQRFGMQRSEVRFFLRHERSPCWESG
TGQRSQDPSLKRNGVKVPGDRRMENGISAPRMDMTLAELQEMASRQQQQIEAQQQMLANK
EQRLKFLKQQDQRQQQQAAEQEKLKRLKEIAENQEAKLKKVRALKGHVEQKRLSNGKLVE
EIEQMNSLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDGYHDNQSAVAELDRLHEFIQL
RNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVNELRERLWKKKAALQQKENVPVSSDGN
LPQPVASAPSRVAAVGPYIQSSTMPRIASRPELLVKPAFSDGTQTLQAPDGPLKTQTLPN
MRAGSSSQAKALAGSVVPSSKPSLSAADWNSLNTDNHVTQGSALTSAEGEAFLRDKEKKV
RPFSMFDSVDQSAGLGSLRKNQSSEDLLREAQTANKNVTKVPPPVPTKPKQINLPYFGQA
SHLQLPDTKLDGNAQKLPLAAVTMGNKQKPAAQQPSHPSQQIQEQILPSSKQESPPAAAV
RPFTPQPSKETSLPPFRKPQTVAASSIYSMYTQQQTPGKNFQQAVQSALTRAQTRGPHFP
SVYGKPVMAGAGVQNQLPLSENVYSNLQGKPGSPEPETETTTSAHENHETERIPRPLSPT
KLLPFLSNPYRNQSDADLEALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTLA
AMETISAPSHPSKQMASAVSPESPVEIPNPYASTESEKEMVSSMPEPAIAEEAENTPVDE
SEAVLPSSALETVPEAVSDVDEPAQPKTEEPSLEASLPLEVYIEEYPPYPPPPYPSGEPE
SLGEDSFNMRPPEVTGQFSLPPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFD
LVQRIIYEVEDPSMPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAA
SCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKG
VIYGLWDYEAQNDDELSMKEGDCMTILRREDEDEIEWWWARLNDKEGYVPRNLLGLYPRI
KPRQRSLA
Download sequence
Identical sequences U3IW96
ENSAPLP00000011521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]