SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011572 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011572
Domain Number 1 Region: 470-553
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.4e-29
Family Forkhead DNA-binding domain 0.0000152
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000011572
Domain Number - Region: 313-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0179
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011572   Gene: ENSAPLG00000011828   Transcript: ENSAPLT00000012301
Sequence length 683
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742527.1:281032:434954:1 gene:ENSAPLG00000011828 transcript:ENSAPLT00000012301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQESGTETKSNGSAIQNGASGGNHLLECSLREVRSNGETPSVEIGAADLTHLQQQQSQA
LQVARQLLLQQQQQQQQQQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQ
QILQQQVLTPQQLQVLLQQQQALMLQQQQLQEFYKKQQEQLQLQLLQQQHAGKQPKEQQV
ATQQLAFQQQLLQMQQLQQQHLLTLQRQGLLTIQPGQPTLPLQPLAQGMIPTELQQLWKE
VTSSHTAEEAASNNHSSLDLSTTCVSSSAPSKTSLIINPHASTNGQLSVHTPKRESLSHE
EHSHSHPLYGHGVCKWPGCEAVCEDFQSFLKHLNSEHALDDRSTAQCRVQMQVVQQLELQ
LAKDKERLQAMMTHLHVKSTEPKATPQPLNLVSSVTLSKTASEASPQSLPHTPTTPTAPI
TPVTQGPSVITTTSMHNVGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLI
RQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVW
TVDELEFQKRRPQKISGNPSLIKNIQTSHTYCTPLNAALQASMAENSIPLYTTASMGNPT
LGNLANAMREELNGAMEHTNSNGSDSSPGRSPMQAMHPVHVKEEPLDPDENEGPLSLVTT
ANHSPDFDHDRDYEDEPVNEDIE
Download sequence
Identical sequences U3IWE7
ENSAPLP00000011572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]