SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011631 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011631
Domain Number 1 Region: 420-520
Classification Level Classification E-value
Superfamily SH2 domain 5.79e-22
Family SH2 domain 0.00085
Further Details:      
 
Domain Number 2 Region: 9-73
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000542
Family SAM (sterile alpha motif) domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011631   Gene: ENSAPLG00000011852   Transcript: ENSAPLT00000012360
Sequence length 540
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743686.1:2074312:2105555:1 gene:ENSAPLG00000011852 transcript:ENSAPLT00000012360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPRNIPYRSEVATWNPDELAEYFKTLKYKDCEKVVRKHSISGQRFLNMSENDIQKFPKL
RVPIVSKLSQEINRNEGRMSFFPKWGQTQKCPENPGYGQEDGGWSSFEEDDDYESPDDDQ
EKEDEADYESPTEEPEDAEHDSDGYEPPPSNNDEAHHNVIFPAKSLANNTDYIDRPSTAR
SSHQPPVPPQRPGPSTVPASFGGRGASLPPFPPLPSNNDLTRDRNIKPSKPPAPSIDRST
KPPLDRLAPPFEREAPVSGRKPSYPDKSSCSSLRSLGEQLAMMPKPPVPPSDRYERGNPT
PLRKQTPVKQKPQHFRNPQEEEDAAPQRAVPQLSLPPYSSNTFPSKSIKPPPKPGSNSMP
GAESSGECKTSARSLSASGSLPPRFPLGNNSRSPSRGTADIRPPLPIPSRQTAQHTNTEE
DEDSLNDEWYVAYISRPEAEAALRKINKDGTFLVRDSSRKTATHPYVLMVLYRDKVYNIQ
IRYQEQNQIYLLGTGLKGKEDFSSVADIIDYFQRTPLLLIDGKDRGSRNQCMLTYAAGHI
Download sequence
Identical sequences U3IWK5
ENSAPLP00000011631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]