SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011831 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011831
Domain Number 1 Region: 61-186
Classification Level Classification E-value
Superfamily PH domain-like 1.06e-52
Family Phosphotyrosine-binding domain (PTB) 0.0000754
Further Details:      
 
Domain Number 2 Region: 534-604
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000441
Family SH3-domain 0.0000923
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000011831
Domain Number - Region: 732-785
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000245
Family Pointed domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011831   Gene: ENSAPLG00000012030   Transcript: ENSAPLT00000012563
Sequence length 828
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742887.1:2881023:2933404:1 gene:ENSAPLG00000012030 transcript:ENSAPLT00000012563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGHISNTPPGGYGSYSPQINGYGSPTFGQAEREQNSRTSAKALYEQRKNYARDSASSIS
ETSQYHVEHLTTFVLDRKEAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDKAVSLVDLE
SKNELENFPLSTIQHCQAVMNACNYNSILALVCKEPTQNKPDLHLFQCDEIKASFIHEDI
ESAISDCKSGKQKKRLETLRMISNADSTIPPPPRAPAPVPPGTITQVDVRSRVAAWSAWA
TEHGEFEKHRQYHDHEETAEMIAARIDRDVQILNHILDDIEYFVTKLQKAAEAFAELAKR
KKTKKSKKKGPGEGVLTLRSKPPPPDEFVDCFQKFKHGFNLLAKLKFHIQNPSAAELVHF
LFTPLHMVVQTTGGPELASTVISPLLTKDTIDFLQYTVTSEEGQLWMSLGDTWTKARADW
PKDQFIPPYVPRFRNGWEPPLLNFMGAPNEQELNHLAESVANFAEQQRKQEIKRLSTEPP
GVPDYPPSDGYAFSNTVYKRGPLLDQGAAVAAFKQTVSRHVDRNYEAHNKTQSKKYAKCK
YEFMARNNSELSVMKEEIVEILDDRKQWWKVRNKSGNAGFVPNNILDPLRNYEGDLGLPE
PVYTRAIQKQRTDYAAKQPSPVPATPSPPPTPAPVPAAVPLPPSTPAPIPVPVPKAPATI
SRQSSTSSDSGGSVARDSQRNKQVPVDRRKSQMEEVQDELVHRLTIGRSAAQRKFHVPRP
NIPVVNITYDSSPDDVKAWLESKGFNPVTVNSLGVLTGAQLFSLNKDELKTVCPEGSRVY
SQITVQKSALEANSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH
Download sequence
Identical sequences U3IX55
ENSAPLP00000011831 XP_005017140.1.99704 XP_012952580.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]