SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011876 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011876
Domain Number 1 Region: 268-397,713-888
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.27e-50
Family Diacylglycerol kinase-like 0.025
Further Details:      
 
Domain Number 2 Region: 2-123
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-30
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 
Domain Number 3 Region: 1096-1162
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.57e-19
Family SAM (sterile alpha motif) domain 0.0044
Further Details:      
 
Domain Number 4 Region: 169-238
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.83e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000289
Further Details:      
 
Domain Number 5 Region: 109-165
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000478
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011876   Gene: ENSAPLG00000012041   Transcript: ENSAPLT00000012608
Sequence length 1169
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744955.1:542718:587892:-1 gene:ENSAPLG00000012041 transcript:ENSAPLT00000012608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TIIKEGMLMKQTSSFQRWKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVAESSTKNVN
NSFTIITPCRKLILCADNRKEMEDWIAALKTVQNREHFESTQYSMDHFSGMHNWYACSHA
RPTYCNVCREALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDEDGI
SMPHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTACKELLPNKCPLGLCK
VSVIPPTALNSIDSDGFWKATCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVF
DLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQQCQLGVLPLGTGND
LARVLGWGSACDDDTQLPQILEKLERASTKMLDRWSIMVYETKLPRQASTSTVTEDFSED
SEVQKILFYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKATESSEE
SEVMARKCSVLKEKLDSLLKTLNDESQASSSLPNPPPTIAEETEDGDGSGSACDSSSDRS
VGSSCTARPQIFRPREQLMLRANSLKKAIRQIIEHAEKAVDEQNAQTQEQEGFLLSLSAS
EEGKELRNEDKISLQSSHSSSYGVSKVRNQRKASKSPCERQINKGSLSLGSSASLPPQTG
NRDNLPMLNTKILYPNIRAGMSGSLPGSSVISRLLIHADPFNSEPENLECYTEKCVMNNY
FGIGLDAKISLDFNNKRDEHPEKCSFRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLEC
DGRPIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDTFTAPSFDDKILEVVAVFGSMQMAV
SRVINLQHHRIAQCRTVKIAILGEEGVPVQVDGEAWIQPPGYIWIVHKNRAQTLTRDRAF
ESTLKSWEDKQKCELSRPSSFSLQPEIMSEEESTQINQFGQAAGALIHSIREIAQSYQDM
EQELAHAVNASSKSMDKVYAKSKSTEGLNCSLVVEMVNNVKALHNETELLLAGKMALQLD
PPQKEQLQAALADMDLQLRKLADIPWLWQLMEPCDEENQMLDYSKRSRSGKFRLVTKFKK
EKNNKNKETHSSMGLPVHLWGTEEVAAWLEHLSLCEYKDIFIRHDVRGSELLHLERRDLK
DLGVTKVGHMKRILHGIKELSRNTPVSEV
Download sequence
Identical sequences U3IXA0
ENSAPLP00000011876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]