SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011922 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011922
Domain Number 1 Region: 154-248
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 9.68e-29
Family E2F dimerization segment 0.0000223
Further Details:      
 
Domain Number 2 Region: 79-142
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000363
Family Cell cycle transcription factor e2f-dp 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011922   Gene: ENSAPLG00000012150   Transcript: ENSAPLT00000012654
Sequence length 379
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743057.1:123612:127727:-1 gene:ENSAPLG00000012150 transcript:ENSAPLT00000012654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAAAPAAVPGGFICMQGKPPSPSPRSICCSDALPPGLPPVCPRICPFPXHQYIAESLPAA
RGKPRNPGKGAKSPGEKSRYETSLNLTTKRFLELLSKSPDGVVDLNWAAEVLKVQKRRIY
DITNVLEGIQLITKKSRQSSTWCGCATTRRTSSQHRLLEKELRELQAAERQLDDLIQTCT
VQLRLLRHTAAYVTCQDLRSIVDPSEQMVMVIKAPPETQLQVSDPTEAFQVSVKSTQGPI
DVFLCPEDSSGVCSPVKSPFKAPSEELSPGSSQPRASPLLHPAAQDINMPLLPGEQEALL
PGASVLPSKCPTEEVSLSPLASMDALLEQSKDDFSGFLADEFIALSPPQPQDYHFGLEEG
EGISELFDCDFGDFTPLDI
Download sequence
Identical sequences U3IXE6
ENSAPLP00000011922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]