SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011955 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011955
Domain Number 1 Region: 8-79
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.71e-16
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011955   Gene: ENSAPLG00000012180   Transcript: ENSAPLT00000012687
Sequence length 314
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742808.1:1730182:1735988:1 gene:ENSAPLG00000012180 transcript:ENSAPLT00000012687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNNQLCIRRWTTKNVAKWLKEEGFCEYVDILCNRHRLDGITLLTLTEYDLRSPPLEIK
VLGDIKRLMLSIRKLQKQHIDVLEELGYSSDSHIGTVGAAVGSLQGTDWFCNGEVPRDYD
GPITDLNGDQYQYANGKNKHSTRRLDPEYWKTILSCVYVFIVFGFTSFVMVIVHERVPDM
QTYPPLPDIFLDSVPRIPWAFAMTEVCGVILCYIWLLVLLLHKHRSILLRRLCSLMGTVF
LLRCVTMFVTSLSVPGQHLQCTGKLYGNVWAKLQRAFAIWSGFGMTLTGVHTCGDYMFSG
HTVVLTMLNFFVTE
Download sequence
Identical sequences U3IXH9
ENSAPLP00000011955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]