SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012030 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012030
Domain Number 1 Region: 802-1035
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.53e-66
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00000344
Further Details:      
 
Domain Number 2 Region: 577-717
Classification Level Classification E-value
Superfamily ARM repeat 1.21e-47
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00038
Further Details:      
 
Domain Number 3 Region: 136-276
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-22
Family Ras-binding domain, RBD 0.0077
Further Details:      
 
Domain Number 4 Region: 1065-1190
Classification Level Classification E-value
Superfamily PX domain 6.67e-22
Family PX domain 0.0019
Further Details:      
 
Domain Number 5 Region: 1206-1275
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000405
Family Synaptotagmin-like (S variant) 0.005
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000012030
Domain Number - Region: 436-479
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00376
Family PLC-like (P variant) 0.082
Further Details:      
 
Domain Number - Region: 382-433
Classification Level Classification E-value
Superfamily Subtilisin inhibitor 0.0288
Family Subtilisin inhibitor 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012030   Gene: ENSAPLG00000012232   Transcript: ENSAPLT00000012763
Sequence length 1275
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743580.1:766126:779949:-1 gene:ENSAPLG00000012232 transcript:ENSAPLT00000012763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGKGSPPSSKAPQPRDINMFSQERAHGKLLARRISEEDPYGLADYEGINDAITCLNLKST
YESQVLREASRGWKEGRSIFEKESSGKPVARSKTMPPQVPPRTYVSRFGNRKNLAPNKNR
RISVDPVAPRPHSLGNGYELFEVSEERDEEVAAFCHMLDVLRCTQDYSLSGFVWSSVSLS
PEHLGHGVSLKVTVVCDSLREPLTFTCDCECPLGRGGLRAVDVEDFVLKLCGLEEFLQNK
HALGSHEYIQHCRKFDIDIRLQLMRRKAVRSDLARTANDDQSPSTLNHYIHLQERPIKQT
ISRQALSLLFDTFHNEVDAFLASPCPQGDFPLKAERVIQSVMAICNALAAVESQEITAAL
NQMPPCPSRMQPKIQKDPNVLAKRENRARAAVGRALSLHCTPGHRHPPPHPAAMGFAPSW
GEARATRRAPPLCSPRSYEDFYLSCSLTHGGKELCSPLHTRKAHVYKYLFHLIIWDQHIP
AERGSAPKIAPLVLDVPSPPATPPGPRSRANPARKTPNGVAQGDPMWVLRSPHARAHLDH
HLTGDARSILLPFPSSRVLYRCLPNPVRAGGGWAPRLWEKRYYCHAAPGALPMLLASAPS
WEWACLPDIYALLGQWSCMSHQDALGLLHATFPDQEVRRTAVQWIDSISDTELLDYLPQL
VQALKYECYLDSPLVRFLMKRAICDLKITHYFFWLLKDGLKDSQFSIRYQYLLGLCXELW
GRRGVYGVRRGLSPLVSPPQGILREGLEEVKQFFKANGSCRLPLSPSLRAQNGDTAPPKN
RGQPAPDAPPLALGAPHPGGSQCGDDLRQDMLTLQMIRIMNKIWVQEGLDMRMVIFRCFS
TGRGRGMVEMIPNAETLRKIQVEHGVTGSFKDRPLADWLQKHNPEEDEYEKAVENFIYSC
AGCCVATYVLGICDRHNDNIMLKTTGHMFHIDFGRFLGHAQMFGNIKRCGAPFVFTSDMA
YVINGGDKPSSRFHDFVDLCCQAYNLIRKHTHLFLNLLGLVRAWGPLAAPQNXRPRCRLI
ESSLGSVATKLNFFIHNLAQMKFTGSDARPTLSFAPRTHTIKTAGRIRDVFLCRHERVFN
PSKGYIYVVKVQRESPSEVVFVQRTFEEFQELHNKLRLLFPSSLLPRYPLRPYTRGWGGS
PCPAVAERRKEELNGYIWHLIHAAPEAPQCDLIYTFFHPLPRDEKAAGTSPAPKPADATW
ARPLGKVGGEVKLSISYKNNKLFIMVMHIRGLVGARRRGADPDPYVKTYLLPDPQKTTKR
KTKVARKTCNPTYNE
Download sequence
Identical sequences U3IXQ4
ENSAPLP00000012030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]