SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012096 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012096
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-28
Family Ras-binding domain, RBD 0.0000351
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000012096
Domain Number - Region: 275-336
Classification Level Classification E-value
Superfamily HR1 repeat 0.0209
Family HR1 repeat 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012096   Gene: ENSAPLG00000012331   Transcript: ENSAPLT00000012829
Sequence length 417
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742884.1:332613:336422:1 gene:ENSAPLG00000012331 transcript:ENSAPLT00000012829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKVWVDGIQRVVCGVSEQTTCQEVVIALARAIGQTGRYVLVQKLREKERQLLPLECPL
ESLAKCGQYANDVQFILRRTGPSVAERPSSEGAPQAPERPREPRKSMTFNLGPVGSGELF
AKSRWRQHAWEGMELKAAGPASSPQLSKEELFKTVLRQQEQLSSLEAHGDTLETDLRFWE
HGRAPSQEDEILYLEHLVRRNETELGEEEFWQSELRLEKECERERQERVRSLRASLEEYT
QRIYELSARTEALQKEIQWEMAERAKRGKESPVPSPTDLEDMAAKMKRDLEAKVKQGTQL
ESNLASVEKALEEAERSLQAQNQELEELNKELRQCNLQQFIQQTGATVTVGQARSEEDAQ
PEPSPRELPACRRNGGQRDSPPRASTKQLLGHPQNLPEPLVSSLNPEVLSTRQSIWR
Download sequence
Identical sequences U3IXX0
ENSAPLP00000012096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]