SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012109 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012109
Domain Number 1 Region: 418-502
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.99e-29
Family Forkhead DNA-binding domain 0.00000903
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000012109
Domain Number - Region: 262-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0286
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012109   Gene: ENSAPLG00000012306   Transcript: ENSAPLT00000012842
Sequence length 630
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742515.1:1249580:1310521:-1 gene:ENSAPLG00000012306 transcript:ENSAPLT00000012842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQALLQQQQAVMLQQQQLQEFYKKQQE
QLHLQLSQESKQKRQSVPGKEPYFSQWHSSESMQSLACTCQQTASNINIIQTKHVEKRER
ANRPLAAQQLVFQQQLLQMQQLQQQQHLLNLQRQGLISIPPGQSALPVQSLPQAGLSPAE
IQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSTTSKASPPITHHSIVNGQSSVLN
ARRDSSSHEETGASHTLYGHGVCKWPGCESVCEDFGQFLKHLNNEHALDDRSTAQCRVQM
QVVQQLEIQLSKERERLQAMMTHLHMRPSEPKPSPKPLNLVSSVTMSKNMLETSPQSLPQ
TPTTPTAPVTPITQGPSVITPASVPNVGAIRRRHSDKYNIPMSSEIAPNYEFYKNADVRP
PFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVRV
ENVKGAVWTVDEVEYQKRRSQKITGSPTLVKNIPTSLGYGAALNASLQAALAESSLPLLS
NPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVKEEPVIAEDEDC
PMSLVTTANHSPELEDDREIEEEPLSEDLE
Download sequence
Identical sequences U3IXY3
ENSAPLP00000012109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]