SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012124 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012124
Domain Number 1 Region: 237-303
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000266
Family Ras-binding domain, RBD 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012124   Gene: ENSAPLG00000012335   Transcript: ENSAPLT00000012858
Sequence length 371
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742619.1:2169718:2178546:-1 gene:ENSAPLG00000012335 transcript:ENSAPLT00000012858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLARVGAAFVPDVSAELASPLPCALESTHLKSSSWSYFFPDQVPKCGFLFEMIFYSREQ
LSSLLKTYNSYYSDQQNLQLSLNQREGSVPFIEGILSIFWGLRHPIRLKIHDEKQLPSFV
TLKSTENFSYNGMTRWGEFDDLHHISGETVKSNEEKLSPEKSYSCYESSTLKSKSEQEHD
CATLPRAVSDGAAVRKRTKFPMIARTEVETHRVSINGHFYNYETSVFTPAFGSETKIRIN
SYMRTREVIEQLLRKFKIENSPHEFALYIIHASGEKKQLRSGDIPLLHRLLQGPSEKIAK
FFLMDRRVEEVSGDVAQYIQFHLPFLESILHRINEEEEQEIQQTIAKYLKEKQMIKQHLQ
NRTVKKTETTV
Download sequence
Identical sequences U3IXZ8
ENSAPLP00000012124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]