SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012258 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012258
Domain Number 1 Region: 104-202
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 5.75e-36
Family E2F dimerization segment 0.00033
Further Details:      
 
Domain Number 2 Region: 27-91
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.9e-17
Family Cell cycle transcription factor e2f-dp 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012258   Gene: ENSAPLG00000012476   Transcript: ENSAPLT00000012993
Sequence length 231
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742696.1:1189542:1194552:-1 gene:ENSAPLG00000012476 transcript:ENSAPLT00000012993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQPPMLNLNLDGDVQVVRKTLKAKRPRFDASLVYLTRKFMDLVKRAPDGVLDLNEVATTL
GVRKRRVYDITNVLDGIHLIQKRSKNLIQWVGSNLDQVVGKAAEQQNLKDELSDLSAMEE
ALDELIKDCAHQLFDLTDDKENAKYPYVTYQDIRSIQAFQKQIVIAIKAPEETKLEIPIP
KEDCIEVHVKSTKGPIDVYLCEVEQDKPGAKTFENMNTVKSETEPSVPPGE
Download sequence
Identical sequences U3IYD2
ENSAPLP00000012258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]