SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012345 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012345
Domain Number 1 Region: 300-442
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-39
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 196-301
Classification Level Classification E-value
Superfamily Second domain of FERM 6.93e-37
Family Second domain of FERM 0.00000268
Further Details:      
 
Domain Number 3 Region: 115-195
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.96e-27
Family First domain of FERM 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012345   Gene: ENSAPLG00000012505   Transcript: ENSAPLT00000013080
Sequence length 1100
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742524.1:2169316:2231993:1 gene:ENSAPLG00000012505 transcript:ENSAPLT00000013080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGSDSESKDKEQDQQETPAQPGAAEVQPQDQQQQQQLSEEQQNALEQFSAVAAHST
PVKKEQATDKEQEFAAASAKQLEYQQLEDDKLSQKSSSSKLSKSPLKIVKKPKNMQCKVT
LLDGSEYACEVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDTENQKNWLDPAKEIKKQI
RSGAWQFAFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQS
ELGDYDPDEYGSDYVSEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSM
YGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGE
FEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQ
TRRASALIDRPAPYFERSSSKRYTMSRSLDGASVNENHEIYMKDSVSAAEVGTGQYATTK
GISQTNLITTVTLTPVSAIRHDTKPPLLGADSRHSSPSSQPGPHASSAKLRRRCKESARK
KSLGCESPKEGAPKHGESEPDSDRKGRVCSAEQDVGFGYKQKASKGGTLFSFSLQLPESF
PSLLDDDGYLSLPNLSETNLLPASVQHYLPIRSPSLVPCFLFIFFFLLSASFSVPYALTL
SFPLAMCLCYLEPKAASLSASLANDLSDSSEEETDSEQTDTAADGETTATESDQEEDGDL
KAQDLDKTQEDLMKHQTNISELKRTFLETSTETAVSNEWEKRLSTSPVRLAARQEEAPMI
EPLVPEETKQSTGEKTLDGSDIFSLIESARKPTEFIGGVTSTSHSWAQRIDTTTSQETAS
SEMKQAAEPHQDAVTKVVQETVVIEERRGMNVHASGDPAKVAGLVLDAQAQAASAAAASV
KGKEGSAVTEGAKEEKREEADKAVTKQEGVAAAATSHEQAEEHSTTVQVSDSLERKPHFE
SPVVKTETISFSSVPAGGESLEISTKEVPVVHTETKTITYESSQVDCGADSEPGVLMSAQ
TITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDM
SVTKVVVHKETEITPEDGED
Download sequence
Identical sequences U3IYL9
ENSAPLP00000012345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]