SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012398 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012398
Domain Number 1 Region: 117-390
Classification Level Classification E-value
Superfamily SAICAR synthase-like 4.9e-97
Family Inositol polyphosphate kinase (IPK) 0.00000000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012398   Gene: ENSAPLG00000012584   Transcript: ENSAPLT00000013136
Sequence length 391
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744676.1:619452:654675:-1 gene:ENSAPLG00000012584 transcript:ENSAPLT00000013136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVLPPVIPRLTVTPEEGEEAQGSPKAPPSHAXXXSGWLRTDSSLHLQSRRLSTSSLSSTG
SSSLLEDSEDDVLSDTEGRSQGIVHLEHGEEHNQKKAWNTIKTMVNLPVISPFKKRYSWV
QLAGHTGSFKAADSGKILKRFSENEKECFERLMKDPLRSCVPCFHGVVERDGESYIQLDD
LLTDFEGPCVMDCKMGIRTYLEEELTKAREKPKLRKDMYKKMIEVDPLAPTAEENAQHAV
TKPRYMQWRETISSSANLGFRIEGIKKADGTCNTNFKTTKTQEQVLQVFVEFIEGNTTIL
KKYLKRLQEIHIILESSDFFKRHEVVGSSLLFVHDGSGNANVWLIDFGKTTLLPDGQTLD
HRIPWQEGNREDGYLLGLDNLIRILESITER
Download sequence
Identical sequences U3IYS2
ENSAPLP00000012398 XP_005029211.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]