SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012441 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012441
Domain Number 1 Region: 952-1238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.44e-54
Family Tandem AAA-ATPase domain 0.00018
Further Details:      
 
Domain Number 2 Region: 1247-1456
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.66e-47
Family Tandem AAA-ATPase domain 0.00084
Further Details:      
 
Domain Number 3 Region: 1575-1769
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 8.63e-46
Family Sec63 N-terminal domain 0.0000847
Further Details:      
 
Domain Number 4 Region: 741-914
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 9.42e-45
Family Sec63 N-terminal domain 0.0022
Further Details:      
 
Domain Number 5 Region: 218-388,417-471,509-605
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.31e-43
Family Tandem AAA-ATPase domain 0.00085
Further Details:      
 
Domain Number 6 Region: 1806-1915
Classification Level Classification E-value
Superfamily E set domains 6.44e-24
Family Sec63 C-terminal domain-like 0.00063
Further Details:      
 
Domain Number 7 Region: 619-724
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000188
Family Forkhead DNA-binding domain 0.081
Further Details:      
 
Domain Number 8 Region: 1456-1558
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000087
Family Z-DNA binding domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012441   Gene: ENSAPLG00000012589   Transcript: ENSAPLT00000013180
Sequence length 1937
Comment pep:novel scaffold:BGI_duck_1.0:KB742658.1:228794:463641:-1 gene:ENSAPLG00000012589 transcript:ENSAPLT00000013180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFELLGPEGFELIEKLLQNRSLIVERSLTCANDNKFQALQEQCRKLIGENTKPNYGCQVT
IQSEQEKLLMKQYRREEKRNARKEKQAGEDGESSGEGLMCFDPKELRMQRELALLNARSM
PVLGRQREMDFERIHYPHVYDSRAEAMKTSAFIGGAKVFLPEAVQRENNKMYEEVKIPHS
EPMPIGIEEKIVYIKDLDEIGQLAFKGMKRLNRIQSIVFETAYNTNENMLICAPTGAGKT
NIAMLTVLHEIRQHVQHGVIKKDEFKIVYVAPMKALAAEMTNYFSKRLEPLGITVKELTG
DMQLSKGEILRTQMLVTTPEKWDVVTRKSVGDVALSQLVKLLILDEVHLLHEDRGPVLES
IVARTLRQVESTQSMIRILGLSATLPNYLDVATFLHVNPYIGLFYFDGRFRPVPLGQTFI
GIKTTNKVQQLNHMDEVCYENVLKQIMAGHQVMVFVHARNATVRTAMGLREKAKNNGHIC
HFLSPQGSDYGQAEKQVQRSRNKQLRELFPDGFSIHHAGMLRQDRSLVENLFSNGHIKVL
VCTATLAWGVNLPAHAVVIKGTQIYAAKRGSFVDLGILDVMQIFGRAGRPQFDKFGEGII
ITTHDKLSHYLTLLTQQNPIESQFLESLADNLNAEIALGTVTNVEEAVKWISYTYLYVRM
RANPLVYGISHKAYQMDPSLEKHREQLVIEVGRKLDKARMIRFEERTGFFSSTDLGRTAS
HYYIKYNTIETFNELFDAHKTDGDILAIVSKAEEFEQIKVREEEIEELDTLLNDFCELPA
PGGVENNYGKINILLQTYISRGEMDSFSLISDSAYVAQNAARIVRALFEIALRKRWPAMT
YRLLNLSKVIDKRLWGWVSPLRQFSVLPPSVLSKLEEKNLTVDKMKDMRKDEIGHMLHHV
KIGLKVKQCVHQIPSIAMEATIQPITRTVLRVRLNITPDFTWNDQVHGTVGEPWWIWVED
PTNDHIYHSEYFIVQKKQVITKEPQLLVFTIPIFEPLPSQYYIRAVSDRWLGAEAVCIIN
FQHLILPERHPPHTELLDLQPLPVTALGHREYEVLYKFTHFNPIQTQIFHTLYHTDCNVL
LGAPTGSGKTVAAELAIFRVFNKYPTSKAVYIAPLKALVRERIEDWKVRIEEKLGKKVVE
LTGDVTPDMRAIAQADLIVTTPEKWDGVSRSWQNRSYVQKVSILIIDEIHLLGDERGPVL
EVIVSRTNFISSHTEKPVRVVGLSTALANARDLADWLNINQMGLFNFRPSVRPVPLEVHI
QGFPGQHYCPRMASMNKPAFQAIRSHSPAKPVLIFVSSRRQTRLTALDLIAFLATEDDPK
QWLKMDEREMNDIIVTVRDSNLKLTLAFGIGMHHAGLHERDRKTVEELFVNCKIQVLIAT
STLAWGVNFPAHLVIVKGTEYYDGKTRRYVDYPITDVLQMMGRAGRPQFDDQGKAVILVH
DIKKDFYKKFLYEPFPVESSLLDVLADHLNAEIAAGTITSKQDAMDYITWTYFFRRLIMN
PTYYNLEDVSHDTMNKYLSSLVEKSLFDLECSYCIEIGEDNRSIEPQTYGRIASYYYLKH
PTIGMFKDQLKPESNIEELLLILTNAEEYTDLPVRHNEDQMNSELAKHLPIEVNPHSFDS
SHTKTHLLLQAHFSHAMLPCPDYATDTKTVLDQAIRICQAMLDVAAHHGWLVTALNITNL
VQMVVQGRWIHDSSLLTLPNIEVHHLYLFRKWSQEKRKSVHGGYQGPIECLPELMAACEG
RENVFASIVDSELQTAHISQAWNFLSRLPILNISLSIKGCWDDAVQPQNEVPVPLLTTDT
RDDKRWIKLHADQEYVLQINLQRTQMGYQQGKQDSKAVAPRFPKVKDEGWFLILGEVDKK
ELIALKRTGYVRNRNTVSVAFYTPETPGKCIYTLYLMSDSYLGMDQQYDIYLNIIPAGTS
AQGTAEVSDAMSHLTLS
Download sequence
Identical sequences U3IYW5
ENSAPLP00000012441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]