SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012463 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012463
Domain Number 1 Region: 585-875
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-83
Family Protein kinases, catalytic subunit 0.000000000989
Further Details:      
 
Domain Number 2 Region: 2-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-73
Family Ephrin receptor ligand binding domain 0.000000879
Further Details:      
 
Domain Number 3 Region: 296-501
Classification Level Classification E-value
Superfamily Fibronectin type III 1.28e-40
Family Fibronectin type III 0.0000587
Further Details:      
 
Domain Number 4 Region: 881-949
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000749
Family SAM (sterile alpha motif) domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000012463
Domain Number - Region: 226-299,334-351
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00116
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012463   Gene: ENSAPLG00000012538   Transcript: ENSAPLT00000013203
Sequence length 955
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742943.1:1349743:1547089:-1 gene:ENSAPLG00000012538 transcript:ENSAPLT00000013203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWIPR
NSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHSVKFREHQFTKIDTIAAD
ESFTQMDLGDRILKLNTEVREVGPVSRKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNL
AVFPDTVPMDSQSLVEVRGSCVNHSKEEEPPKMYCSTEGEWLVPIGKCLCNAGYEERGFA
CQACRPGFYKASAGNVKCAKCPPHSSTYEDASLNCRCEKNYFRSEKDPPSMACTRPPSAP
RNVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGGSSKLCEPCSDNVRFLPSQTGL
TNTTVTVVDLLAHTNYTFEIDAVNGVSDLSTLSRQFAAVSITTNQAAPSPITVIRKDRTS
RNSVSLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRAKGTNVTISGLKPDTTYVFQI
RARTAAGYGTNSRKFEFETSPDSFSISSENSQVVMIAISAAVAIILLTVVVYVLIGRFCG
YKKSKHGADEKRLHFGNGHLKLPGLRTYVDPHTYEDPNQAVHEFAKELDASNISIDKVVG
AGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGV
VTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLA
ARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTSPEAIAYRKFTSASDAW
SYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNR
PKFEQIVSILDKLIRNPSSLKIITNAAARPSNLLLDQSNVDIAAFRSTGDWLNGFRTGQC
KDIFTGVEYSSCDTIAKISTEDTKKIGVTVVGPQKKIVSSIKALETHTKTSPVPV
Download sequence
Identical sequences U3IYY7
ENSAPLP00000012463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]