SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012471 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012471
Domain Number 1 Region: 582-764
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.79e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.0000778
Further Details:      
 
Domain Number 2 Region: 103-389
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.8e-32
Family FCH domain 0.024
Further Details:      
 
Domain Number 3 Region: 513-560
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000224
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012471   Gene: ENSAPLG00000012672   Transcript: ENSAPLT00000013212
Sequence length 967
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742978.1:34056:45009:1 gene:ENSAPLG00000012672 transcript:ENSAPLT00000013212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISSPTPGLDSQERVPENKKRYSEIFRSLDDLEISIGNATVDLFIGDADGTDDTDLSAERE
IVPTATVLMLNESFCKSKSSSEKQVHTDMTVEEADEMLIKCEGGIDAALEYAKMWCKYVK
ELLNWIEKRLSYETEFAKGIVKIAESGRNAILQQQSNMPLRALYAMVLEHDIKVGNSANE
TVGLLQQKEFYQPLSAKKNEIEKWRKEFKDQWTKEQKRMLCLSKNESLSSLRKSRLQYAQ
RCEELEKAKYLSAKAEDEYQSAAVVNPSSASKQLEKRRRSCEEAQAKVQETEALYKMCIN
DANFRRQELEKVRARIVSHIRKLIYQGDEVLTKVTLRMFKQRQTQSEHIPVGYQHLAEVC
KPYKVGEKYLEFIQALQKKDIHMEVFEFESLASGGQRSPPSSRKKLSLQHTGGSKEASTP
EDTSRRQFSPNGTNRSLCSDTESLGGSCESRSLDSPNSSPGNSNRKLLKAPSTGTMSSSD
DFEERDSLQTFENENGSSQQQFRNILLSSAAQTHRLRKLRGPSKCRDCDNFMVNGFECEE
CYLACHKKCLESLLITCGHRKLPNRVPLFGIDFTQVPRDFPEEVPFIVVKCTSEIEARAL
GVQGIYRISGSKARVEKLCQAFEESRSLVELSEHPFLLQLSGPVLLYQLYNSLIALAKEI
QKPGEERTDCAGVPSDPIQSMKELLSKLPGSNYNTLRHLIAHLYRVAEKYEENKMSPNNL
GIVFGPTLIRPGSGSDVSMSCLVDSGYQAQIVEFLIQNYERVFGMEDLPPSLPLSCENPS
QEAPTVLRALSSSPAPWLSPHNSSHRLHSTLKKKIGITPPRMNTSTGSELEDLEDSMQER
TDSDSDTVVGTQPRGHFSRQPVKYIRVQAKTKTTTLSSMATDTGAEGNATESSSTAKDVL
GERTRSRNSSPDTSTLRGRSGGKQQLKHFEMTEETARIISKLKADDASASPEGSLESLGS
AEKEVKL
Download sequence
Identical sequences U3IYZ5
ENSAPLP00000012471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]