SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012516 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012516
Domain Number 1 Region: 50-147
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 1.83e-30
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00012
Further Details:      
 
Domain Number 2 Region: 131-246
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-28
Family UBX domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012516   Gene: ENSAPLG00000012737   Transcript: ENSAPLT00000013257
Sequence length 288
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742629.1:2628604:2642917:1 gene:ENSAPLG00000012737 transcript:ENSAPLT00000013257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNIKTVKEEWMCKSRTDDQILNGTEQNRDYFVDNLFEEAQKIGAICMSPTTVKNQVDVI
IKLWKNGFTVNDGELRSYADVASQQFLDSVKKGELPFELRKVFEKEEVDVKVEDKKDEVY
LSSKKPVFHPFSGHGYRLGSATPRIVSKVREDHQAAGDKRPLPVVPLNDLEPITNIQIWL
ADGERVIQKFNVSHRISHVRDFITKYRGSEGRVPFTLTTSLPFRELRDETLTLQEAKLQN
AVVVQRLQKTTEPFRLLKAPDNDCKTAATSNGQLKNEQKSTIKSTRSN
Download sequence
Identical sequences U3IZ40
ENSAPLP00000012516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]