SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012529 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012529
Domain Number 1 Region: 144-347
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.9e-45
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.0002
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000136
Family Interferon regulatory factor 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012529   Gene: ENSAPLG00000012752   Transcript: ENSAPLT00000013271
Sequence length 347
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742884.1:385356:387613:-1 gene:ENSAPLG00000012752 transcript:ENSAPLT00000013271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAWAQASGRYEGSPEDPAKWKTNFRCALRSTHMFVTLEDNSKNSDDPHKVFAVTSXPGST
TAPTTQSMTLEDLDTLQWVLQHCNISNTDPTPSPWPPGPGQGGCLPPTAFQEWGPAAEQP
PLGAYGPSEHMLLGEQTIPGIPPHLDVTIYYRGKTVHQEVVNDRQCLLTYQSLDPVVVLQ
PGQHVFFPSPEGLADSKQRQYTEELLLGVGLRLEQRAGKLFATRLKKCKVFWALSQQLDN
GRPPPNLLCRDQETSIFDFHRFCTDLRDFRDNRRERSPDFTIFLCCRQCFSNCKPKESKL
ILVKLVPKFCEHWYEQVQRQGASSLNSGNVSLQLSDSFNLYELIEQY
Download sequence
Identical sequences U3IZ53
ENSAPLP00000012529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]