SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012698 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012698
Domain Number 1 Region: 34-118
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.63e-23
Family La domain 0.00074
Further Details:      
 
Domain Number 2 Region: 119-190
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.01e-21
Family Canonical RBD 0.0031
Further Details:      
 
Domain Number 3 Region: 465-571
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000176
Family Canonical RBD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012698   Gene: ENSAPLG00000012887   Transcript: ENSAPLT00000013441
Sequence length 602
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743012.1:521949:545367:-1 gene:ENSAPLG00000012887 transcript:ENSAPLT00000013441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGMETEVARDNAMEEESTEQKKEREKKKRSRVKQVLADIAKQVDFWFGDVNLHKDRFLR
EQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARAVKSSSVVELDLEGTRIRRRQPLGEQ
PKDVDSRTVYVELLPKNVNHSWIERVFGKCGNVVYVSIPRYKSTGDPKGFAFVEFETKEQ
AEKAIEFLNNPPEEAPRKPGIFPKTVKNKPVPALNTSNSTVVVLYFFYTEEKKKKKKKKS
KIKKESNTQAAAETKESNTNTTTEQVPKSKRPRTSSECSEMGGTEVHRQPSKREKRKWDR
TESTEVPAESRPGKRKRSSSGDAETPIAKVKKTVQKDEVHPVKQETEEAPKDSNEVPAED
DKNGDKKDTSLSKSKRKHKKKHKERHKMGEEVIPLRVLSKTEWMDLKQEYLALQKASMAS
LKKTMSQIKPEPVGEMETDGCAQKKPQSKNAKSTSEDSAPPVKANTMGPQFVSGVIVKII
STEPLPGRKQIKDALALLADVAYVDMLEGDTECHVRFNTPEDAQTVIKSHKEIQIKNNWK
YEVLTGDNEQRYWQKILVDRQAKLNQPREKKRGTEKLIAKAERIRLEKTQQTSKHIRFSE
DN
Download sequence
Identical sequences U3IZM1
ENSAPLP00000012698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]