SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012746 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012746
Domain Number 1 Region: 145-336
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.82e-86
Family p53 DNA-binding domain-like 0.000000673
Further Details:      
 
Domain Number 2 Region: 524-589
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.71e-20
Family SAM (sterile alpha motif) domain 0.00002
Further Details:      
 
Domain Number 3 Region: 372-412
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.00000000000432
Family p53 tetramerization domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012746   Gene: ENSAPLG00000012917   Transcript: ENSAPLT00000013489
Sequence length 660
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744899.1:480386:562176:1 gene:ENSAPLG00000012917 transcript:ENSAPLT00000013489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFVETPSHFSWKESYYRSAMSQSSQPREFLSPEVIQHIWDFLEQPICSVQPIDLNFIDDP
SENGPTNKIEISMDCVRLQDTELSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTEHTQ
NSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKK
LYCQIAKTCPIQIKVLTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAP
PSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRP
ILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSTKNGDGTKRPFRQ
GTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQ
QQHQHLLQKQTSMQSQSSYGSNSPPLSKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMG
TNIPMMGTHMAMTGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSS
CVDYFTTQGLTTIYQIEHYSMDDLVSLKIPEQFRHAIWKGILDHRQLHDFSSPPHLLRTP
SGASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE
Download sequence
Identical sequences U3IZR9
ENSAPLP00000012746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]