SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012767 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012767
Domain Number 1 Region: 44-212
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.01e-53
Family Group II chaperonin (CCT, TRIC), apical domain 0.00015
Further Details:      
 
Domain Number 2 Region: 239-356
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.31e-33
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00066
Further Details:      
 
Domain Number 3 Region: 2-50,205-240
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 1.1e-23
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012767   Gene: ENSAPLG00000012960   Transcript: ENSAPLT00000013511
Sequence length 364
Comment pep:novel scaffold:BGI_duck_1.0:KB743913.1:38095:43051:1 gene:ENSAPLG00000012960 transcript:ENSAPLT00000013511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNRCHRQMAEIAVNAVLTVADMERKDVDFELIKVQGKVGGRLEDTQLVKGVIVDKDFSHP
QMPKELKDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMVKQIKDTGA
NLAICQWGFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGFAG
IVREISFGTTKDRMLVIEQCQNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLVRDNR
IVYGGGAAEISCALAVSEAADKCPSLEQYAMRAFADALEVIPMALSENSGMNPIHTMTEV
RARQVKENNPALGIDCLQKGTNDMKQQHVIETLIGKKQQISLATQVVRMILKIDDIRRPG
ESEE
Download sequence
Identical sequences R0L5F4
ENSAPLP00000012767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]