SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012925 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012925
Domain Number 1 Region: 298-619
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-89
Family p120GAP domain-like 0.0000943
Further Details:      
 
Domain Number 2 Region: 578-715
Classification Level Classification E-value
Superfamily PH domain-like 7.77e-46
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 
Domain Number 3 Region: 146-308
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.7e-26
Family Synaptotagmin-like (S variant) 0.028
Further Details:      
 
Domain Number 4 Region: 18-133
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.83e-23
Family Synaptotagmin-like (S variant) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012925   Gene: ENSAPLG00000012988   Transcript: ENSAPLT00000013671
Sequence length 836
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743304.1:96578:173716:1 gene:ENSAPLG00000012988 transcript:ENSAPLT00000013671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSLQEEGGKLSSCISLSLGEAKNLPTYPGPNKMRDCYCTVNLDQEEVFRTKIVEKSLCPF
YGEDFYCEIPRTFRHLSFYIFDRDVFRRDSIIGKVAIQKEDLQKYHNRDTWFQLQHVDAD
SEVQGKVHLELRLSEVITDTGVVCHKLATRVLECQGLPIVNGQCDPYATVTLAGPSRSEA
KKTKVKKKTNNPHFDEVFYFEVTRPSSYNKKSHFDIEDVDEVDKMEIRVDLWNASNLKFG
DEFLGELRLPLKFLRQSSSYEAWYFLQPRDNGNKSLKPDDLGSLRLNVVYTEDHVFSSDY
YSPLRDLLLKSADVEPVSASAAHILGEVCREKQEAAIPLVRLFLHYGRIVPFISAIANAE
VKRTQDPNTIFRGNSLTSKCIDETMKLAGMHYLQVTLKPIIDEICQVHKPCEIDPVKLKD
GENLENNRENLRQYVDRIFTVITKSGVSCPTVMCDIFFSLRESAAKRFQGDLDVRYTAVS
SFIFLRFFAPAILSPNLFQLTPHHPDPQTSRTLTLISKTIQTLGSLSKSKSANFKESYMA
TFYDYFNEQKYADAVKNFLDLISSSGRRDHKSIEQPILLKEGFMIKRAQGRKRFGMKNFK
KRWFRLTNHEFTYQKSKGDHPLCSIPIENILAVERLEEESFKMKNMFQVIQPERRVLYIQ
ANNCVEAKDWIDILTKVSQCNKKRLTVYHPSAYLNGHWLCCKATADNTPGCTPCTGGLPA
NIQLDIDGDRETERIYSLFNLYMPKLEKMQEACGSKSVYDGPEEEEYSTFIIDDPKETYK
TLKLIIEGVGTLEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQTYIRQQSEISAHSI
Download sequence
Identical sequences U3J098
ENSAPLP00000012925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]