SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012988 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012988
Domain Number 1 Region: 18-148,404-524
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 2.75e-78
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.001
Further Details:      
 
Domain Number 2 Region: 211-377
Classification Level Classification E-value
Superfamily GroEL apical domain-like 7.59e-43
Family Group II chaperonin (CCT, TRIC), apical domain 0.0011
Further Details:      
 
Domain Number 3 Region: 156-217,370-404
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 1.62e-26
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012988   Gene: ENSAPLG00000013136   Transcript: ENSAPLT00000013735
Sequence length 535
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742384.1:172366:183722:-1 gene:ENSAPLG00000013136 transcript:ENSAPLT00000013735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QASISLAPVNIFKAGADEEKAETARLSSFVGAIAIGDLVKSTLGPKGMDKILLSTGRDST
VTVTNDGATILKAIGVDNPAAKVLVDMSKVQDDEVGDGTTSVTVLAAELLREAELLISRK
IHPQTIIAGWRAATKASREALLKAAVDHGDDEAKFREDLMNIAGTTLSSKLLTHHKDHFV
KLAVEAVLRLKGSGNLEAIHVIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIA
NTGMDTDKIKIFGSRVRVDSTAKVAEIEQAEKEKMKEKVERILKHGINCFINRQLIYNYP
EQLFGAAGIMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLI
HFSGVAMGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDTRTVYGGGCSEMLMANA
VTELAIRTPGKESVAMESFAKALRMIPTIIADNAGYDSADLVAQLRAAHSEGKSTYGLDM
KEGTIGDMAVLGVTESFQVKRQVLLSAAEAAEMILRVDDIIKAAPRKRVPDHRPC
Download sequence
Identical sequences U3J0G1
ENSAPLP00000012988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]