SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013016 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013016
Domain Number 1 Region: 141-674,799-994
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.97e-261
Family Motor proteins 0.00000000172
Further Details:      
 
Domain Number 2 Region: 1684-1873
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.26e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000756
Further Details:      
 
Domain Number 3 Region: 1616-1673
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000374
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.007
Further Details:      
 
Domain Number 4 Region: 18-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000145
Family Ras-binding domain, RBD 0.038
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000013016
Domain Number - Region: 993-1043
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000496
Family Motor proteins 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013016   Gene: ENSAPLG00000013123   Transcript: ENSAPLT00000013764
Sequence length 2135
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744667.1:297410:332692:1 gene:ENSAPLG00000013123 transcript:ENSAPLT00000013764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTDADSAVCQAKAAYNLHIYPQLSAESAPCCKVTATKDTTSSDVIKDVINILNLDVSK
HYVLVEVKESGGEEWVLDINDSPVHRVLLWPRRAQDEHPQKDGYYFLLQERNTDGSIKYA
QMQLLSKETDARRLVERGFLPWHQEDFDDLCNIPNLTEKTLLENLKCRFLKHKIYTYAGS
ILIAINPFKFLPIYNPKYVKLYENHQLGKLEPHIFAIADVAYHTMLKKHINQCIVISGES
GSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFIQ
VNYLENGIVRGAVVEKYLLEKSRLVSHEKGERNYHVFYYLLLGVNEEERKEFHLKQPEDY
FYLNQHNLKIEDGEDLRHDFERLKQAMEMVGFLSSTKKQIFSVLSAILYLGNVTYKKKAT
GREEGLEVGPPEVLDILSQLLKVKREILVEVLTKRKTVTANDKLILPYSLNEAITARDSM
AKSLYSALFDWIVLRINHALLNKKDMEESVTCLSIGVLDIFGFEDFETNSFEQFCINYAN
EQLQYYFNQHIFKLEQEEYKSEGITWHNIDYTDNVACIHLISKKPTGLFYLLDEESNFPH
ATNQTLLAKFKQQHEDNKFFVGTPVMEPAFIIRHFAGKVKYQIKDFREKNMDYMRPDIVA
LLRSSDSAYVRELIGMDPVAVFRWAVLRAAIRAMAVFAEAGRQRAQKTAGVVRQGPRVPL
GELQRSNTPVEKVYRDMHEQIIASIKGLPWQGDDPCKLLRSLNRLQHRSHFMKSRGIKQK
QIIPKNLLDSKSLKLIVSMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLLETLGKAE
PFFIRCIRSNAEKKEMLFDESLVLQQLRYTGMLETVRIRRSGYSAKYTFQEFIDQFQVLL
PKNARASKEDIFAYLNKLQLDKNYCQIGKTKVFMKEAERQILQETLHKEVIRKIILLQSW
LRMVLERRRFLRTRQAAIVLQACWRSRCVRRSLQRNNAAVYIQSVWRRYREQKYYLQQKK
RICLMQAMVRGHLQRKRFQKMAIEKQKAEEEQRKMHEALDRENDMSKDEGNEPATDQLPV
KHESEPEEAVGGKDEAPNEQAENLSSSEKATLPQKNMTEGSEKVTNSREKREFRRQRGLE
HNELQNKHVLLSFEGAALTCHEEQTSSEEALETVPDPKISTEQDALLQGSSVEEKSPNEE
QPPASEVGKVDKTVDRVEAERNQNNLLKGSQSCPERPTNLALNLENTFSATGSSQTPTEG
WADKNKRLAQKATKDLDSPTSSNIQRYVDDPGKLKYKREKWKGKRQSDAGQNDMLSQSLD
GRTRADQSPQDPLAKKGTSSSLNDLSTLAQSVAMNQQSPDTIEEEKGNKKSPLQKKPSDL
LPTTDSAVSMQPASQQIDAKSAFKSPLRRLLGKKPDKKIPKEYPDVIDEEGFGRIQFSCL
RIKISFSASSGQPSRLQAGERHVKESSKTKKNRTIKISKISSVSQNWRASMVREIANANE
LKHLDEFLLNKINDLRSQKSGVECLFFEATEKFRGNIKTMYSAPNGQIHVGYKDLVENYQ
LLVTNLAKKREEKEVKLVLNLFQSLLDEFIRGYAKKEESEQPKQTKAQKKKRKQDRSIEE
HNGHVFTNYQVSIRQSCEHCSSYIWPMEKACLCSVCKLICHKKCMSKIQSSCTSCGKKNE
QDTEPRHFGVCVSSLTSERNSVPVVMEKLLEYVEMHGLYTEGIYRKSGSANRMKELKQLL
QADPNSVKLENYPIHTITGILKQWLRELPDPLMTSAQYNDFLRAVELPEKQEQLCAIYSV
LEQLPQANHNTLERLIFHLVKVALIEDVNRMSPNALAIVFAPCLLRCPDTSDPLTSMKDV
SKTTMCVEMLIKEQIRKYKIKMDEINQLEAAESIAFRRLSLLRQNTLWPVKLGFSSPYEG
MLSKSPQVKGNDSSNSELDSLNEEEEVSEADNREKEILIDRLQSIKEEKEDITYRLPELD
QRGSDEENVDSETSASTESLLEERTGRMDTEDFTAYSQPVPSLLQTYSSSSSASLASRRR
LSLTLSKIKVPRRTPVMPTANIKLPPGIFKCTESQGRISANEESQIVVKRREQPARRTDK
IHSVYIAQGSAVAHAQELLNEYEPTAKVKRRFSDP
Download sequence
Identical sequences U3J0I9
ENSAPLP00000013016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]