SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013021 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013021
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.26e-50
Family Vacuolar sorting protein domain 0.00023
Further Details:      
 
Domain Number 2 Region: 144-209
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.77e-22
Family Vacuolar sorting protein domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013021   Gene: ENSAPLG00000013216   Transcript: ENSAPLT00000013769
Sequence length 226
Comment pep:novel scaffold:BGI_duck_1.0:KB743922.1:125793:130919:1 gene:ENSAPLG00000013216 transcript:ENSAPLT00000013769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFQMSKQLDMFKTNLEEFASKHKQEIRKSPAFRVQFQDMCATIGVDPLASGKGFWSEMLG
VGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQEVSQDDLLRAIKKLK
VLGNGFGIIPVGGTYLVQSVPAELNMDHTVVLQLAEKKGYVTVSEIRSSLKWEMERAKQI
LEHLLKEGMAWLDTQAAGEPQYWLPALFTELYSQEITPEEAKEAIP
Download sequence
Identical sequences R0L8I7
ENSAPLP00000013021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]