SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013136 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013136
Domain Number 1 Region: 563-861
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-81
Family Protein kinases, catalytic subunit 0.000000000374
Further Details:      
 
Domain Number 2 Region: 5-168
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.45e-58
Family Ephrin receptor ligand binding domain 0.0000118
Further Details:      
 
Domain Number 3 Region: 283-485
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-29
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 4 Region: 854-898
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000089
Family SAM (sterile alpha motif) domain 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000013136
Domain Number - Region: 215-282,320-336
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00439
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013136   Gene: ENSAPLG00000013276   Transcript: ENSAPLT00000013884
Sequence length 899
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742616.1:797405:803754:-1 gene:ENSAPLG00000013276 transcript:ENSAPLT00000013884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLPTVVLLDFAKAQGELGWLTQPYGKGWDLLQNMMNDSQIYMYLVCNVLEGEQENWLRTN
WIYRSEAQRVFIELKFTVRDCNSFPSGGGSCKETFNLYYAESDVDYGTNFQKRQFKKITI
APDEITVQDDFTNRNVKLNVEVRSVGPLRRKGFYLAFQDLGACVALLCMAHFPETVAGAD
SQTLAEVRGSCVEDAVADEAPTLHCNADGDGALGQCQCRAGYEAVGDQCQACPPGTFKAE
VSPSGCXPAHTLPAPAASASCPCEDGHFRAPSDPADAPCTRDPSPPSSVTAVGLGASVQL
RWSPPSDTGGRQDVTYSVTCEQCWPESGECRPCDGGIRYSQPPRGLVGTGVTVTDLEPHV
NYTFTVEARNGVSAFSAHRSVAAASISVNQTEPPRVTSVSLDGRTATSLVLSWTVPLRQQ
SRVWKYEVTYSKKVDENSYSVLRCEGASVTIPKLSPATAYVVRVQALTQDGHGAFSPEHE
FETLPEGAESMASAAVISGSVTGVLFVVLLLAALIYVLRRRRSSRSRQSPEDVYFSKSDQ
LKPLKTYVDPHTYEDPNQAMLKFTTEISPSSITRQKVIGAGEFGEVYKGTLKRGKKEVPV
AIKTLKVGYTEKQRVDFLSEASIMGQFCHHNIIRLEGVVSKYKPFMIITEYMENGALDKF
LRDKDGEFCVIQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRV
LEDDPEATYTTSGGKIPIRWTAPEAISYRKFTSASDVWSYGIVMWEVMSYGERPYWELSN
HEVMKAINEGFRLPAPLDCPSAVYQLMMQCWQQERSRRPKFADVVSILDKLIRAPESLKT
LADFDPRVSIRLPSTSGSEGVPFRSVPEWLESIKMHQYAEHFMAAGYSTIEKVLQMTSE
Download sequence
Identical sequences U3J0V9
ENSAPLP00000013136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]