SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013282 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPLP00000013282
Domain Number - Region: 1-28
Classification Level Classification E-value
Superfamily RING/U-box 0.000184
Family RING finger domain, C3HC4 0.036
Further Details:      
 
Domain Number - Region: 124-174
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0126
Family Ubiquitin-related 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013282   Gene: ENSAPLG00000013439   Transcript: ENSAPLT00000014031
Sequence length 288
Comment pep:novel scaffold:BGI_duck_1.0:KB744727.1:11802:15041:1 gene:ENSAPLG00000013439 transcript:ENSAPLT00000014031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFY
AAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLERKGNKEKEKSKEEV
NDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRN
GPLPLKYRVRPTCKRMKIGHQREGLNNSGELESDSGSDKASSPAGGIPSTSSCLPSPSTP
VQSPHPQFPHISSTMNGTSSSPSSNHQSSFTNRARKTSINGSSATSSG
Download sequence
Identical sequences U3J1A5
ENSAPLP00000013282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]