SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013389 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013389
Domain Number 1 Region: 8-261
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-67
Family p120GAP domain-like 0.0000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013389   Gene: ENSAPLG00000013584   Transcript: ENSAPLT00000014140
Sequence length 274
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744005.1:98:1936:1 gene:ENSAPLG00000013584 transcript:ENSAPLT00000014140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVATPQAFLIDLGVAELDRFDDREALIFRENTLATKAIDEYMKLVGGKYLQDTLXEALAQ
LCTSDDSCEVDPSKCAGPDLSDNQNNLRGCEETFQRIATPRRAFPAELGEIFAAWQEECA
ARGKAAIGQRLVSASLFLRFLCPAIMSPSLFGLMQEYPDEQTARTLTLIAKVIQNLANFT
TFGEKEAYMGFMNEFLEHHWGPMTTFLQSVANPESSVHMATYDGYVDLALELATLHLLLC
DIFSSLDQATQEELEPLPTILNAIREGTPVPVSV
Download sequence
Identical sequences U3J1L2
ENSAPLP00000013389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]