SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013482 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013482
Domain Number 1 Region: 287-458,490-544,574-667
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.28e-45
Family Tandem AAA-ATPase domain 0.00025
Further Details:      
 
Domain Number 2 Region: 800-981
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.31e-32
Family Sec63 N-terminal domain 0.0026
Further Details:      
 
Domain Number 3 Region: 683-784
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000068
Family Plant O-methyltransferase, N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013482   Gene: ENSAPLG00000013639   Transcript: ENSAPLT00000014234
Sequence length 1431
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744020.1:437864:474040:-1 gene:ENSAPLG00000013639 transcript:ENSAPLT00000014234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNSSDTVFSLDNLFYEKPDAKKRERDLEKEESNLWYIAPAPVIGEIPAAEELQRELKKN
ELQRKLEKNTASNHMVYARANPIKNYLFNIVSEKEMLQLSVGEREKINVQHESLEMVSLF
LSPDQDKYKRGTGICQQPDANFSQSKILINIPENGDDESAHSTLRRSLFKLSDCMYKNTK
FKDSSVDMKQVDTYLNTSENMTEARKDSDFTLHRVNDGNTASKIGFQIKSLPSASRILDK
HSTDQGTTGRNLEMLRAVTEIPTQFRSIFKEFPYFNYAQSKALDDLLYTDRNFVICAPTG
SGKTVMFELAITRLLMEAPMPWLNIKIVYMAPIKALCSQRYHDWKEKFGPIGLNCKELTG
DTVMDDLFEIHRAHIIITTPEKWDSMTRRWRDNSIVQLVRLFLIDEVHVIKDESRGATLE
VVVSRMRTIQSSLWRLSENHDVVPPLRFVAVSATIPNAEDIAEWLSDGKMPAVCLKIDED
QRPVKLRKIVLGFPCSDNQTEFKFDLTLNYKIASVIQTYSEQKPALVFCATRKGVQQAAS
VLSKDAKFLLSVEQKQRLQRSANSLKDSKLRDLLMYGVAYHHAGMEVCDRKIIEGAFTDG
DLPVLFTTSTLAMGVNLPAHLVVIKSTMHYVGGMFEEYSETDILQMIGRAGRPQFDTTAT
AVIMTRWSTREKYIQMLNGADIIESSLHRHLVEHLNAEIVLHTVTDVTVALEWIRSTFLY
IRALKNPTHYGFSSGLDKIGIEAKLQELCLKNLNDLSSFNLVRMDKENSFKPTETGRLMA
WYYIAFETVKQFFTIKGTETLNELVTMISNCAEFLDVKLRINEKKILNTLNKDKDKITIR
FPLEGKIKTREMKINCLIQAQLGCIPLQDFTLTQDTGKIFRNGIRITRWLSDFLASSKTN
FSALLNSVILAKCFRCKLWENSLHVSKQLEKIGVSLSNAMVNAGLTTFKKIEETNARELE
LILNRHPPFGNQIKESVLHLPKYELDIEQLPKYSDTLAEILVTIKLTNFEQLQRKRTAPD
FHYLTLIIGDADNQVIFIQKIMDSVLLKTGNWMKKIEVRRALKSEDISINLISSDYEVGL
DIQQAFTAFYLMPRTVGGKVVTNKKLKAESPLGMYYGSPQSPPAAEKYGNRECNHRCKNK
DVCGHDCCKTGVPPKSEMNGDSKFTLYLADLRSRNSTSSVPPVKRLKMQMLNQAQNVDLK
HFGFASKSLMPALSMDLVDNVNSLGISQKQLQSWNYGKSKSNFFPLHFHITLCFNVNSEL
REDIWNDLDDEILVYASDFSSGELGKKINHFYIDHGNTCLHIPDEHETRCKYATSKATSD
ISKGLQGETSSQNPFFSVLNSSSKVELPVQSGYINTLSFQEEKHSNPSQELKNIQCSSIS
KAISDSFKSTREEDFFFTKEQEEEIEPRYLLDVDDEISDVKPLLGLFDDIL
Download sequence
Identical sequences U3J1V5
ENSAPLP00000013482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]