SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013515 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013515
Domain Number 1 Region: 111-193
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.19e-16
Family SAM (sterile alpha motif) domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000013515
Domain Number - Region: 51-115
Classification Level Classification E-value
Superfamily EF-hand 0.0104
Family Calmodulin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013515   Gene: ENSAPLG00000013672   Transcript: ENSAPLT00000014268
Sequence length 504
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743168.1:5752:45664:-1 gene:ENSAPLG00000013672 transcript:ENSAPLT00000014268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RICCRNLVLGRCPPYGRLCASHRRAEGPDPLPAPAAEFCRIDKPLCHDEDEQLSFEAVRN
IHKQMDDDANGNVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKTSEVY
NWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVNNATMMGTVLKMTDRSHRQKL
QLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEG
LHRAEQSLHDLQESLQISQRKSRAVKSEKGFPILHLKTLIPISHREVMETRDIADGTCLQ
LPSFAQTYKLLSRVRMALKNAEKELESHCSWAAPEALQKWLQLTHEVEVQYYNIKKQNAE
KQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRW
QQIELLCGFQIVNNPGIHTLASALNIDQSWMGTPRPNPSHFIMTDDVDDLDEEIVSPMSI
QSPALPSTVRQRLVDPQHAHGSQR
Download sequence
Identical sequences U3J1Y8
ENSAPLP00000013515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]