SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013530 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013530
Domain Number 1 Region: 114-199
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.27e-25
Family La domain 0.0000123
Further Details:      
 
Domain Number 2 Region: 193-273
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000543
Family Canonical RBD 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013530   Gene: ENSAPLG00000013661   Transcript: ENSAPLT00000014284
Sequence length 729
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743463.1:248305:259588:-1 gene:ENSAPLG00000013661 transcript:ENSAPLT00000014284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFCSLQQVTSKGAGLNPNAKVWQEVPQGSGEAVPPTNGAEHSWQDTAAAQGTHPEGNIEI
SEDSCKQYEVMYSTPCEATRNGTGVDEAAANGIVLATEDLGYQIYEVSGEGSSAVSTEDI
RECLRKQLEFCFSRENLSKDLYLMSQMDSDQFVPIWTIANMEGIKKLTTDMDLILEVLRS
SPMVQVDETGEKVRPNHKRCIIILREIPETTPIEEVKALFKNENCPKVISCEFAHNNNWY
VTFQSDTDAQQAFKYLREEVKTFQGKPIMARIKAINTFFAKNGYRVVDSSVYTQPVQTQA
QFASPLFMQPVYSPQQYSIYSIVPQTWSPSPAPYFETPLAPFPNGGFVNGFNTPGSYKTN
AASLSIGRPFHRNRVKPHFRSSNSSEHAVEGPAAASTVSMGDGPLNRTNSRNFVMERHNS
TLTGHQDQGYSQKDSPTAQIEQNGDYGIGRGRRNIFRGRRRREDDRISRPQPSVETKTPT
PKFDLLASNFPPLPGSTAKIPGEPVLESRMSDIVKGICKEKESKELLSSCPTPAQEEQTH
STVQQPVTSASSSGQSEAVVLSTVQPDSKPEEVSVQKDVTSHTSPSVSVCPVSAPKPPRT
NTTSPSTNASAAPPVSMQEPRKLSYAEVCQKPPKEPPPVPVQPLRELRTNIVPPAKNEEN
GTPEKALEKPHDKVEGRMKDYSGFRGNGPPRGAAGKIREQRRQFGRRSSPQGAPRRIGKE
QYVPPRSPK
Download sequence
Identical sequences U3J203
ENSAPLP00000013530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]