SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013646 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013646
Domain Number 1 Region: 2-73
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-23
Family Dual specificity phosphatase-like 0.022
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000013646
Domain Number - Region: 423-499
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0314
Family BCR-homology GTPase activation domain (BH-domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013646   Gene: ENSAPLG00000013824   Transcript: ENSAPLT00000014408
Sequence length 565
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742849.1:517642:523291:1 gene:ENSAPLG00000013824 transcript:ENSAPLT00000014408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKVMAFALQEGRVAVHCHAGLGRTGVLVACYLVFATRMTADQAILFVRAKRPNSIQTRG
QLLCIREFTQFLIPLRNVFACCEPKAHTVTLSQYLTRQRHLLHGYESRHLKHVPKLIHLV
CKLLLDLAENRQVIEAELLDVPDLSAEIEKTVSQLVSAQLDKELARQDSDTSDSSHAHSA
PFETQDSLFSLAHECDPLWKRRNIDCLQPLTHVKRRLSYSESDLRRTEFLLEQAETAWTV
PAQILQCNKLKQNSGEECSAKDDQKPQLDINKEALVRNTCTIWSQTKFNLDGRKDGSSVH
HRRNSTKEVQRSRTFSSGLSSIHTSRETRTPRQNFANEIGHRKERMTNMYSRKVYVSEDS
DSSSSSKVNFSIGCESQGSKDLSEAIPHIVLQSELSLEGRRVLAAKALANINEFLEEDEV
KQKVEMWQKELNSRDGAWDKICTERDPFILCSLMWSWIEQLKEPIISKDDIDMLAKNCTE
SQDALNLLRKEQCQTILCILHCVVNLQMLPADVEEALLARAIKAFTKTSFDSEDGPYVYN
TLKKVFKQTLEEKRKKLKEGTENPS
Download sequence
Identical sequences U3J2B9
ENSAPLP00000013646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]