SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013719 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013719
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.86e-29
Family Forkhead DNA-binding domain 0.0000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013719   Gene: ENSAPLG00000013909   Transcript: ENSAPLT00000014481
Sequence length 103
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743404.1:656651:833127:-1 gene:ENSAPLG00000013909 transcript:ENSAPLT00000014481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLIAMAIRDSAGGRLTLAEINDYLMSRFPFFRGAYTGWRNSVRHNLSLNDCFVKVLRDPA
RPWGKDNYWMLNPSSEYTFADGVFRXSYPEVCSRPPLPAPGPR
Download sequence
Identical sequences U3J2J2
ENSAPLP00000013719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]