SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013721 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013721
Domain Number 1 Region: 174-256
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.65e-16
Family SAM (sterile alpha motif) domain 0.02
Further Details:      
 
Domain Number 2 Region: 32-97
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000464
Family RING finger domain, C3HC4 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013721   Gene: ENSAPLG00000013901   Transcript: ENSAPLT00000014483
Sequence length 451
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744498.1:118899:126393:-1 gene:ENSAPLG00000013901 transcript:ENSAPLT00000014483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEMEEDETSQGEPERAEVKARATPEISRKISVSEFHCHCCYDILVNPTTLNCGHSFCRHC
LALWWVSSKKNECPECREKWEGFPKVNILLRDVIERLFSDAIEQRKEDIQQNSDVARSLT
TFQKYGNDQISTAPNTGRINPRGGGFFSGVLTALTGVAVVLLGYHWSSREFEDDLLVHKP
VAKWTVEEVILWLEQLGPWASHYKEKFLLEKVNGRLLLTLTEEDFTKEPYSIVNNNHRKA
IMAELECVKTLGVKPPQNLWEYKAVNPGKSLFILYALKSSPRLSMLYLYLFDYAEAFLPF
IHTICPMQENQYEDIVTKLLDLKHPSWKQWREFIVKYLFVPYQLIAEFAWDWLDVHYWTS
RFIIVNAMLHSVLELLTFWRLWSRRELKTIPHRMWRHFWKVSTQGLFVAIFWPFIPQFVC
NCLFYWALYFNPIINIDLVVKEVRRLETQVQ
Download sequence
Identical sequences U3J2J4
ENSAPLP00000013721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]