SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013724 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013724
Domain Number 1 Region: 1112-1289
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00063
Further Details:      
 
Domain Number 2 Region: 674-788
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.45e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.002
Further Details:      
 
Domain Number 3 Region: 434-560
Classification Level Classification E-value
Superfamily PH domain-like 2.68e-23
Family Pleckstrin-homology domain (PH domain) 0.0000263
Further Details:      
 
Domain Number 4 Region: 882-1026
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-19
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 5 Region: 1421-1528
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-16
Family Pleckstrin-homology domain (PH domain) 0.052
Further Details:      
 
Domain Number 6 Region: 576-689
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000184
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 7 Region: 7-69
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000101
Family SAM (sterile alpha motif) domain 0.00042
Further Details:      
 
Domain Number 8 Region: 1003-1104
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000147
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000013724
Domain Number - Region: 1320-1405
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0196
Family Ras-binding domain, RBD 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013724   Gene: ENSAPLG00000013894   Transcript: ENSAPLT00000014487
Sequence length 1683
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742949.1:996528:1113000:-1 gene:ENSAPLG00000013894 transcript:ENSAPLT00000014487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTGNDTDIEEFLVNINLGQYLPNFKEYGYNIVTDCTGINNSVLQQMGVLPTGHRRRIL
KQLDTALSKRQGHLLNENVKLKDSTGLEKKQYLCVDEDSPVSNLNAGETDLIPATSSVQL
PNEAYFGEERFKLGEQNLSEASDDSITNLDFSGLYQNSDSIVKAVSLSGSIKMNAQPDTS
LEEAAAYQTDEHLAGRLAFCDPPSSFAHSCETKYSENKHLMLADEDDLSDCEPSSPFFKF
QGEMINNDLYDSCTQNSTTVFPRASRSFMLRHRPVPEIPESSKGIPGGRNRREKKKTKSS
GKIMSMQSYREEKPPIISPYGETFFWDNLQDAKTRGKNSEFKPLEKLTAGENGAATYLCT
IPDSCRSSHNQDEKTKECAKKPVSQENKSLAPEDFESESVYSVVDQCSLPLKKKKNKAKS
HSSCSKNRSEDANHLISEQMDFRQFDGAQISIANESITPYACFYGPSVKKLKAGWLDKLS
PQGKRMFQKRWVKFDGDSISYYNNEKEVFSKGIILLSAIATVRVHGENKFEVVTSHRTFV
FRVDKEEERNDWVNTILNALKSQSDNHSQSRTSVAPEKSGYLELKGYKAKIFVLLQGNTV
WICKNEQDFKTGFGITLIPMNVANVKQVDRTAKQSFEIITPYKSFSFTAESEREKQDWIE
ALQQSIAETLSDYEVAEKIWFNESNRSCADCKAPNPDWASINLCVVICKKCAGQHRSLGP
RDSKVRSLKMDASIWSNELIELFIIIGNKRANSFWAGNLPPDEELHMDAPAEKRIAFITQ
KYKEGKFRKAPFLYKTKEQLNKALCAAVVKQDVLETLMLLFSGADVMCATGDPVYSTPYL
LAKKAGQRLQMEFLYHNKFSDFPSYDICLESGFSEDSSHSTFLCEFLYKVSSNTTKLLTE
KKLKEDCNKRWCTLESGFLSYYENDKTTTPNGMLDISEVICLVVHKSDFFLNRGDVFTFE
IYLMSERVFLFGAETAYSQRKWTWAIAKHFVPPVAECLLERDCDLIGQLYYKDCHSLDQW
RKGWFAIEKSSLYFCLEMENAQEDSIYLRRLQELTISSVMQNGEKIDVLLLVEKGRTLYI
HGHTKLDFMVWYTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGLGSKQIYLK
NGNSSNVAELLESFKKDARSVKLRAGKHQLEDVTDVLKSFLSQIDDALLTKELYPFWISA
LADMQNEKERVRKYGAFIRTLPPVNKATLAALIEHLYSRVQKCSEINHMNPHNLAMVFSS
CLFQTKGQTSEEVNVIEDLIKNYVQLFDINEDQVKQMDIENSFITRWKDTQVSQAGDLLI
EVYVERKEPDCSIIIRVSPLTEAEELTNDVLGIKNITPNKDDIWAAFEVLENGELERPLH
YTENVLEQVLHWSSLPEPGTAYLIIKRFLTTDMMKLYSEKNVKGSVKAGYLKYKEEPSKL
LSGNKFQERYFVLREGNLLLYKDMKASKPEKVLPVNSLKLYLGVKKKMKPPTNWGIAVFS
EKHQWHICCDGQDTQMEWMISIFTAQHADIWPPAGKARKQSITKSPKIGGLPLIPIQQEN
TTCKIRGSIENIQLGLGKPKLSDHNEDDLLEERKNLKEKASIVAQCLERKEEKVRNHAKA
HRSFISEDIGVGKTDLCQRPHKPLKKNKNKTNKTALELDKKLPSNVIQELNTVLQKNRAL
HDE
Download sequence
Identical sequences U3J2J7
ENSAPLP00000013724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]