SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013762 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013762
Domain Number 1 Region: 51-289
Classification Level Classification E-value
Superfamily L domain-like 3.91e-25
Family Internalin LRR domain 0.024
Further Details:      
 
Domain Number 2 Region: 337-422
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.16e-16
Family Ubiquitin-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013762   Gene: ENSAPLG00000013944   Transcript: ENSAPLT00000014527
Sequence length 424
Comment pep:novel scaffold:BGI_duck_1.0:KB743456.1:324814:339873:-1 gene:ENSAPLG00000013944 transcript:ENSAPLT00000014527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGI
TCAGDENEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPHLEFLNLSSNPLSLSVLERR
CAGSFAGVRKLVLNNSKASWETVHTILQELPDLEELFLCLNDYETVSCSPVCCQSLKLLH
ITDNNLQDWTEIRKLGIMFPSLDTLILANNNLTTIEETEDSLARLFPNLRSINLHKSGLH
CWEDIDKLNSFPKLEEVKLLGIPLLQSYTTEERRKLLIARLPSIVKLNGSIVADGEREDS
ERFFIRYYMEFPEEEVPFRYHELVTKYGKLEPLAVVDLRPQSSAKVEVHFQDKVEEMSIR
LDQTVAELKKHLKTVVQLSTSNMLLFYLDQEAPFGPEEMKYSSRALHSYGIRDGDKIYVE
PRMK
Download sequence
Identical sequences R0JMP4
ENSAPLP00000013762 XP_005023266.1.99704 XP_013042664.1.65836 XP_013042665.1.65836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]