SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013801 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013801
Domain Number 1 Region: 13-120
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.65e-40
Family GABARAP-like 0.00000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013801   Gene: ENSAPLG00000013983   Transcript: ENSAPLT00000014566
Sequence length 121
Comment pep:known scaffold:BGI_duck_1.0:KB742697.1:91483:98853:1 gene:ENSAPLG00000013983 transcript:ENSAPLT00000014566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPADLSQQQSGCLMDRCKEVQQIREQHPNKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPISEIYEQEKDEDGFLYMVYASQETFG
Y
Download sequence
Identical sequences U3J2S4
ENSAPLP00000013801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]