SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013865 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013865
Domain Number 1 Region: 458-657,759-1014
Classification Level Classification E-value
Superfamily Ras GEF 2.88e-111
Family Ras GEF 0.0002
Further Details:      
 
Domain Number 2 Region: 201-339
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.44e-44
Family DEP domain 0.000000209
Further Details:      
 
Domain Number 3 Region: 666-768
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.39e-33
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 4 Region: 24-153
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.13e-26
Family cAMP-binding domain 0.00000033
Further Details:      
 
Domain Number 5 Region: 332-461
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.17e-26
Family cAMP-binding domain 0.000000964
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013865   Gene: ENSAPLG00000013981   Transcript: ENSAPLT00000014632
Sequence length 1016
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743045.1:64386:205466:-1 gene:ENSAPLG00000013981 transcript:ENSAPLT00000014632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVHRARSNEAVGNCCPLFSCRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLQQICLCG
YYENLEKGITLFRQGDIGTNWYAVLTGSLDVKVSDTSNHQDAVTICTLGIGTAFGESILD
NTPRHATIVTREYSELLRIEQKDFKALWEKYRQYISGLLTPPYGVMETGSNNDRMPDKEG
TPLIEPHIPHRPTKTITQVPSEKILRAGKILRNAILSRAPHMIRDRKYHLKTYRQCCVGT
ELVDWMMQQSPCVHSRSQAVGMWQVLLEEGVLNHVDQEHYFQDKYLFYRFLDDEREDAPL
PTEEEKKECDEELQDTMLFLSQIGPDAHMRMILRKPPGQRTIDDLEIIYEELLHIKALSH
LSTTVKRELAGVLIFESHPKAGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGD
DFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEK
IPAGNRVSNQGNSQPQHKYIVMSGTPEKILEHFLETMRLEVTLNEATDSALNDFIMMHCV
FMPNSQLCPALMAQHGTYHAQPSQGTEQEKMDYALNNKRRVIRLVLQWAALYGDLLQEDE
AAMAFLEEFYVSVSDDTRMIAALKEQLPELEKIVKQVSEEPKAPQKKHKVLLQLFNTSDD
RAQKRQPIRGSDEAVLFKVYCIDQTYTTIRVPVSSSVKEVISAVADKLGSGEGLIIVKMS
SGGEKVVLKPHDVSVFTTLSVNGRLFACPRDQFDSLAPLPEQEGPSTGTVGTFELMSSKD
LAHQMTIYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEICLCS
QLSKRVQLLKKYIKIAAHCKEYKNLNSFFAIIMGLSNVAVSRLSLTWEKLPSKFKKIYAE
FESLMDPSRNHRAYRLTVAKLDPPIIPFMPLLIKDMTFTHEGNKTLTDNLVNFEKMRMIA
NTVRTVKFCRSQSFNPDAALTNKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRA
Download sequence
Identical sequences U3J2Y8
ENSAPLP00000013865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]