SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013873 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013873
Domain Number 1 Region: 24-297
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.77e-95
Family Inositol polyphosphate kinase (IPK) 0.00000000697
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013873   Gene: ENSAPLG00000014056   Transcript: ENSAPLT00000014640
Sequence length 302
Comment pep:novel scaffold:BGI_duck_1.0:KB743374.1:68147:84454:-1 gene:ENSAPLG00000014056 transcript:ENSAPLT00000014640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKSWRKIKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLM
NDVLKPYVPAYHGDIVKDGERYNQMEDLLAEFDSPCVMDCKMGVRTYLEEELIKARKKPS
LRKDMYQKMIEVDPDAPTEEENVLRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVN
RDFKKTRTKEQVTEAFREFTRGNRNVLNSYLIRLKGIRATLETSPFFKCHEVIGSSLLFI
HDKKEQAKVWMIDFGKTTPLPEGQVLQHNVPWVEGNREDGYLWGLDNLIQILTELSQKED
SH
Download sequence
Identical sequences R0JPP0
ENSAPLP00000013873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]