SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013877 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013877
Domain Number 1 Region: 33-282
Classification Level Classification E-value
Superfamily SAICAR synthase-like 6.87e-86
Family Inositol polyphosphate kinase (IPK) 0.0000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013877   Gene: ENSAPLG00000014056   Transcript: ENSAPLT00000014644
Sequence length 283
Comment pep:novel scaffold:BGI_duck_1.0:KB743374.1:68159:77475:-1 gene:ENSAPLG00000014056 transcript:ENSAPLT00000014644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSEAVHFSESKSWRKIKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCES
EQRCLDRLMNDVLKPYVPAYHGDIVKDGERYNQMEDLLAEFDSPCVMDCKMGVRTYLEEE
LIKARKKPSLRKDMYQKMIEVDPDAPTEEENVLRAVTKPRYMQWRETISSTATLGFRIEG
IKKEDGTVNRDFKKTRTKEQVTEAFREFTRGNRNVLVIGSSLLFIHDKKEQAKVWMIDFG
KTTPLPEGQVLQHNVPWVEGNREDGYLWGLDNLIQILTELSQK
Download sequence
Identical sequences U3J300
ENSAPLP00000013877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]