SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013891 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPLP00000013891
Domain Number - Region: 204-250
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00109
Family TrmB-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013891   Gene: ENSAPLG00000014078   Transcript: ENSAPLT00000014658
Sequence length 274
Comment pep:novel scaffold:BGI_duck_1.0:KB749019.1:34:2806:1 gene:ENSAPLG00000014078 transcript:ENSAPLT00000014658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWFQARDLMLMSHLQDNIHHADPPVQV
RDPKREVRLGTPWSCKAWFEIPSPIGLAQLGPVWCHLGPIWWILGPFGAILMDFVPFGAV
LIQFDAIWGQFAGFWYHLGPIYWIWVPPRSHCLSLSCSHFSIVNEKMNGKVWDLFPEADK
VRAMLVRKIQEEAVTSSGCGGSGSMEILADMFQLDLPTVHSIISKMIINEELLWVPQASL
DQPTQTVMMWGGYGMVMGWLWGSYGAELWVPQAS
Download sequence
Identical sequences U3J314
ENSAPLP00000013891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]