SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013899 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013899
Domain Number 1 Region: 428-545
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.04e-48
Family MBT repeat 0.00000878
Further Details:      
 
Domain Number 2 Region: 314-426
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.27e-42
Family MBT repeat 0.00000558
Further Details:      
 
Domain Number 3 Region: 530-645
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.17e-35
Family MBT repeat 0.00000851
Further Details:      
 
Domain Number 4 Region: 764-830
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000232
Family SAM (sterile alpha motif) domain 0.0021
Further Details:      
 
Domain Number 5 Region: 637-674
Classification Level Classification E-value
Superfamily CCHHC domain 0.000000000000719
Family CCHHC domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013899   Gene: ENSAPLG00000014035   Transcript: ENSAPLT00000014666
Sequence length 837
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742697.1:111754:129324:-1 gene:ENSAPLG00000014035 transcript:ENSAPLT00000014666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSRAEMEVVRSTKGSAAGEVSVHVVTTESTVQSTHLPTTAFIIPANAATINLPASTLEI
QRFPREPQRSTGAERPERGAGSEPITATVIPQISGVQTCNAVRVLEWKDGVATLPGSNLR
FQINEYGTLKVVSADKMPPLEAIKEGHTEKDGDSEVAPTSRDNPTPAQEQPKLPTPESMC
HCDTCGRRHVSDGVREGRGFCSEHCHQQFKERSVIVENSASSTNTTEILKPVKKRKRKDY
QSPSEEEYESEQMEEKQEETKNSVGDSAISNPEADTWNGSQHGASEEKKEGWSWASYLEE
QKAVAAPLDLFQDYQVASQHKNGFKVGMKLEGIDPQHPSMYFILTVAEVCGYRMRLHFDG
YSECHDFWLNADSPDIHPAGWFEETGHKLQPPKGYKEEEFSWTNYLKITKSQAAPKQLFV
IRNTHEAPPGFEVGMKLEAVDRMNPSLICVATVTDVVDNRFLVHFDNWDDTYDYWCDPSS
PYIHPVGWCQEHGKPLTPPQDYPDPDNFIWEKYLKETGASAVPAWAFKVRPPHGFLVNMK
LEAVDRRTPSFIRVASVEDVEDHRIKIHFDGWSHVYDFWIDADHPDIHPIGWCSKTGHPL
QPPLRPKEPASSSHGGCPTLGCKNMPHTKSSKYSFHHRKCPTPGCDGSGHVTGRFTAHYC
LSGCPLAEKNQGRLKADLSDTEASARKRNLMGFPQRKKSRHHGRGRPPKYRKIQQEDFQT
ISSDNMHQSLFMSALSAHPDRSLSLCWEQHCKLLPGVAGITATTVAKWTIDEVFSFVQTL
TGCEDQAKLFKDEMIDGEAFLLLTQTDIVKIMSVKLGPALKIYNAILMFKNADDTLK
Download sequence
Identical sequences U3J322
ENSAPLP00000013899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]