SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014064 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014064
Domain Number 1 Region: 1821-2106
Classification Level Classification E-value
Superfamily SAICAR synthase-like 6.87e-72
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00051
Further Details:      
 
Domain Number 2 Region: 685-851
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.07e-39
Family Group II chaperonin (CCT, TRIC), apical domain 0.0006
Further Details:      
 
Domain Number 3 Region: 360-490
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.94e-29
Family DEP domain 0.0035
Further Details:      
 
Domain Number 4 Region: 161-233
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000014064
Domain Number - Region: 640-691,844-864
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.0015
Family GroEL-like chaperone, intermediate domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014064   Gene: ENSAPLG00000014164   Transcript: ENSAPLT00000014835
Sequence length 2120
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742873.1:775331:831758:-1 gene:ENSAPLG00000014164 transcript:ENSAPLT00000014835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRAREMAADDKRSPTLDSAGDLPRSPSSPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRF
SKAERAEAAQADPQSLSGGWSSPQHPTRAQSLRSPVPYKKQLSGELQRRASTALDNRRKV
EPPLGSHDPRTAVQLRSLSTVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCSEKFTT
FRRRHHCRLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSNSIGEDL
NALSDSACSVSVLDPGEPRTPVGSRKASRNIFLEEDLTWQSLIHPDSSTTTLSARLGSVQ
EDAGKSPARNRSASITNLSLDRSGSPMVPTYETSVSPQASRTHMKAETSEDERKILLDSV
QLKDLWKKICHHNSGMEFQDHRYWLRTHPNCIVGKDLVNWLIRNGHITTRVQAIAIGQAL
VDGRWLDCVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFD
DSDTEQIADEGEDNLANSASPSKRTSVSSFQSTMDSDSAASISLNVELDNVNFHIKKHSK
YPHVPPHPADQKEYLNPDNGGQQMFSISDAFIKESLFNRRVEEKSKELFFTPLGWHHSSL
DLLREENGEKQAMERLLSANHNHMMALLQQLLYNESLSLSWRDIIVPVVCQVVQTVRPDV
KNRDDDMDIRQFVHIKKIPGGKKFDSMVVNGFVCTKNVAHKKMNSCIKNPKILLLKCSIE
YLYREETKFTCIDPIVLQEREFLKNYVQRIVDVRPNLVLVEKTVSRIAQDMLLEHGITLV
INVKPQVLDRVSRMTQGDLVMSMDQLLTKPRLGTCHKFYMQVFQLPNDQTKTLMFFEGCP
QHLGCTIKLCGAAEYELARVKEILIFMVCVAYHSQLEISFLMDEFAMPPTLTKNTSFHSL
IEEPGDENEQQNLFNGEDFSTAVRDIELSSEKLPAISESVSSHEVTLLEQRGLFERSDQE
NNQLETTSSKQQEHLKLDSSFPVFHSAPPAIPETSLLPLHGMDQHLVTLDSQPLEPLQQA
DDLQESKSQMRVFRDPLQDDSGLYVTEEVTSSEDRLKTYSAAFKQELKDVILCISPVMVF
REPFLLTEKGMRCPAREYFPEQVYWSPLLNKEYKELESRRKRQLLRDLSGLQGMNGSIQT
KAIQILPSHELVNTRIAEHLGDSQSLARMLADYRARGGRILQRSTDPFAQSKDASSVPTG
KTGCRIEEDEKGLSQSESSWSHKVDCLSPVNHQRLCVLFSSSSAQSSNAPSACVSPWIVT
MEFYGKNDLTLGIFLERYCFRPSYQCPSMFCETPMVHHIRRFVHGQGCVQIVLKELDSPV
PGYQHTILTYSWCRLCKQVTPVVPLSNDSWSMSFAKYLELRFYGHQYTRRANVEPCGHSI
HHDYHQYFSYNQMVASFSYSPIRLLEVCVPLPKIYIKRQAPLKVTILQDLKDFSQKVSQV
YLAVDDRLASLKTDTFSKTREEKMEDLFAQKEMEEGEFRNWTEKIQARLLSSSLDTPQQL
QSVFESLIAKKQGLCEMLQAWNNRLQDLFQQEKGRKRPSVPPSPGRLRQGEDSKISSMDA
SPRNASPALQNGEKEDRFLTTLSSQSSTGSTHLQLPTPPEVVSEQLTGAGTLSEQDTTSS
SEDVFDGHSLGSTDSQVKEKSTMKAILANLLPGNNYNPIPFPFDPDKHYLMYEHERVPIA
VCEKEPSSIIAFALSCKEYRNALDELSKASVKSSSEEGPQPNSMSDSKPKSSSPVRLPET
TTGPSNRTAEPEQPKKSSGVLSFFRGTGGKSPDLSSQKKETLRGADSAYYQVGQMGKEGA
ENQGAEPQDEVDGGDGQKKQLVNPHVELQFSDANAKFYCRIYYAGEFHKMREVILGSSEE
DFIRSLSHSMPWQARGGKSGAAFYVTEDVKTDDRFILKQMPRLEVQSFLDFAPHYFTYIT
NAVQQKKPTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNR
NVKTDTGKESCDVVLLDENLLKMVRDNPLYIRSHCKAVLRASIHSDSQFLSSHLIIDYSL
LVGRDDTNNELVVGIIADYIRTFTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCE
AMDKYFLMVPDHWTGLGLNC
Download sequence
Identical sequences U3J3I7
ENSAPLP00000014064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]