SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014098 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014098
Domain Number 1 Region: 919-1018,1515-1692
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.98e-37
Family Tandem AAA-ATPase domain 0.0027
Further Details:      
 
Domain Number 2 Region: 729-792,819-902
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.42e-23
Family Tandem AAA-ATPase domain 0.0051
Further Details:      
 
Domain Number 3 Region: 438-526
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.62e-16
Family Linker histone H1/H5 0.0054
Further Details:      
 
Domain Number 4 Region: 667-730
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000206
Family PHD domain 0.0071
Further Details:      
 
Domain Number 5 Region: 262-323,368-399
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000025
Family Tandem AAA-ATPase domain 0.017
Further Details:      
 
Domain Number 6 Region: 1444-1497
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000298
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014098   Gene: ENSAPLG00000014248   Transcript: ENSAPLT00000014869
Sequence length 1696
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743261.1:255021:297534:-1 gene:ENSAPLG00000014248 transcript:ENSAPLT00000014869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRRKRAPPSKIDDVKKKQLCWNMHEDRRNEVITLDDEMTNEDDVPGPSTSSSSFIVIN
DDSTDEDLSQKEDTGSKSVKFFTVNDEEDSYSTLTSVSVQLNITVLPYRADGSWKALLGE
FALCHPSEQILAEEFHERGFTLMRGDSDDHLQVCVHKKSEEEYSNETKEYLGAYEQIIMV
EPTLGGEILEGLRWLQKKKIIGLYQRPAEAQALKVGIYLLEAGLSKPDFLSDGGGRPKKA
NQLIQKLMEKFYSFIIPDVLEEDEEESDMELERQNIEELYDFVRHTHQQDIQLLREDVQH
PALIPILRPYQSEAVNWMLHRENFTGTPSNENALHFLWREVITLDGVKIYYNPFTGCIIR
EYPCAGPQWPGGILADEMGLGKTVEVLALILTHTRQDIKQDDLTLPEGKLVNFFVPPQPL
EGNKKKKTREMELKLKEKIQYPSLRVMVLAAVKEMNVKKGASIIAIFKYISAVYRYDIQR
NKRLLKRTLEKLIAEQVVEQVKGHGLAGSFKLGKNYKEQKRRERTKEQIARTSERTQKKQ
LTDTNTQTKESKNSDVTSENVLKIPLRVGIATEEHDYCATRKNSKTPEVDHKNSAEENDV
QQEAVVSKSLDLHGSLLVSSDVSSHPDLDVPKGKADIKQEIPKDQSSHSQERASSSVQHA
SSVFPFNTSEYRFECICGELGLVDYKARVQCLKCSLWQHAECVNYKEENLKIKPFYCPHC
LVAMKPVSTGATLIISPSSICHQWVDEINRHVRSSSLRVLVYQGVKKHGFLQPHMLAEQE
VVITTYDVLRTELNYVDIPHSNSEDGRRFRNQKRYMAIPSPLVAVEWWRICLDEAQMVEC
TTAKAAEMALRLSGINRWCVSGTPVQRGLEDLYGLVLFLGIDPYWVKHWWDQLLYQPYCR
KNPRPLYSLIAKIMWRSAKKDVIDQIQIPPQTENVHWLHFSPVERHFYHRQHEVCCQDAL
AKLRKISDWTLKLSSLDRRTVTSILYPLLRLRQACCHPQAVRGEFLPLQKSTMTMEELLT
SLQKKCRTECEEAHRQLVCALNGLAGIHIIKEEYALAAELYREVLRSSEEHKEKLKTDSL
QRLHSTHNLMELLGKHTGIPPTLRDSRLAEEAEQLRQHYMSKSNAEVAEAHQALQPVFQT
IRELQRKIHSGSPWWLDVIQTAIQYAIDEELVQRVQNEITSNYKQQTSKLSMAEKFRDCR
GLQYLLTTQLDEVKKFQKIVREAVKNLEGPPSKQVIEAATICHLRPVRLPLNNCVFCKAD
ELFTEYESKLFSQTVKGQMAIFEEMIEDEEGLVDDRLPTTSRGLWATSETERALKAILSF
AKAHRMDVKLTEEGSIFLELFEAWKKEYKLLHEYWMVLRDHVSAIDELAMATERLRVRHP
DEPKPNPPVLHIIEPHEVEQNRVKLLNDKAVAKSQLQKKLGQLLYLTNLEKSQDKTTGGV
NPEPCPICARQLGKQWAVLTCGHCFCNECIAIIIEQYSVGTRRSSIKCAICRQTTSHKEI
SYVFTAETANQEDDIPVKGSHSTKVEAVVRTLKRIQFKDPGAKSLVFSTWQDVLDIISKA
LYDNNMTFSQINGISKFQENLSAFKYDPKINILLLPLHTGSNGLNIIEATHVLLVEPILN
PAHELQAIGRVHRIGQTKSTIVHRFLIKATIEERMQTMLKTVDRSHTSSSMKQSEASVLT
VADLADLFTEETEELE
Download sequence
Identical sequences U3J3M1
XP_005021605.1.99704 ENSAPLP00000014098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]