SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014112 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014112
Domain Number 1 Region: 313-371
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000296
Family SAM (sterile alpha motif) domain 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000014112
Domain Number - Region: 41-69
Classification Level Classification E-value
Superfamily WWE domain 0.00107
Family WWE domain 0.0074
Further Details:      
 
Domain Number - Region: 237-286
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0293
Family Fungal lipases 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014112   Gene: ENSAPLG00000014268   Transcript: ENSAPLT00000014883
Sequence length 597
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB745279.1:41318:50681:-1 gene:ENSAPLG00000014268 transcript:ENSAPLT00000014883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGREKEAVVVPTSGGRYDVHLKQRQRVAVYWEEEVSEVRRCTWFYKGDKDNKYIPYSEAF
SEELEEAYMIAVTLDEWKKKLESPSREIIILHNPKLMVHYHPVATSDDWGSTPTEQGRPR
TVKRGVENIAVEIPNGEPLQIDHLVFVVHGIGPACDIRFRSIVQCVNDFRNVSLSMLQAH
FKKAQEQQQIGRVEFLPVNWHSSLHSTGVDVDLERITLPSINRLRHFINDTILDVFFYNS
STYCQTIVDTVASEMNRLYQLFLQRNPHFKGGVSIAGHSLGSLILFDLLTNQKAAPEEDE
QSREGSRTASSNTGIEELKEILEKLELSEYCDVFEKEKMDREALFLCTEENLKEVGIPLG
PRMKILNYISSKKERQGASERGAAAPGHSGQAGPDGTSDSRDCQYRDIGLGQVSANYPQL
IYKPTIFFAFGSPIGMFLTVRGVKRINPNYSLPTCKGFFNIFHPFDPVAYRIEPMIVPDV
EFEPMLLPHHKGRKRMHLELKEGLTRMSVDLKNNLLGSLRVAWQSFTFTLHPAASCGGRE
HRRGGRGGRDVKPEEPPPAAKEEASPINVGRLNGGNRIDYVLQEKPIESFNEYLFAL
Download sequence
Identical sequences U3J3N5
ENSAPLP00000014112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]