SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014117 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014117
Domain Number 1 Region: 267-398
Classification Level Classification E-value
Superfamily Second domain of FERM 7.72e-30
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 2 Region: 400-505
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-21
Family Third domain of FERM 0.0074
Further Details:      
 
Domain Number 3 Region: 51-135
Classification Level Classification E-value
Superfamily PDZ domain-like 3.86e-16
Family PDZ domain 0.016
Further Details:      
 
Domain Number 4 Region: 180-261
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000192
Family First domain of FERM 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014117   Gene: ENSAPLG00000014290   Transcript: ENSAPLT00000014888
Sequence length 1524
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743957.1:4646:27088:1 gene:ENSAPLG00000014290 transcript:ENSAPLT00000014888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLETNLIQTRKACRIEQMVAKWLHRSRDGASSGRLPVTNATRDGRGQPASHVRLTVTV
YKDLVLHHYGFEICPNLPLTIASVTAGSTADGKLLPGDQLLRINSTMVEDMSIERVADMI
REAGDELFLTVLRSTSGGPKSSFLTAEKRARLKTNPVKVRFAEEVLVNGHTQGNSLLCMP
NVLKVYLENGQTKAFRFETSTTVKDIVLTLKEKLSIRSIAHFALTLEEQYNAAKVHLLHE
EELIEQVVQKRESHDYRCLFRICFVPKDPLDLLQEDPVAFEYLYLQSCSDVLQERFAVEM
KCSVALRLAALHIQERIYACAHPQKVSLKYIERDWGIENFISPTLLRNMRGKDIKKAISY
HMKRNQILLDPRQKMKHMLAAVQVRLNYLQILSDLKMYNGKIFNATLMLQDRESYVALLV
GAKYGVSQIINSKLNIITSLAEFANISRVELTEESEKVSMVKIYLQDLKKMLTLLLESNS
AKDLVCLIIGYYRLFVDANASIFTWGEKRQQPHRVSAEEGYESRTCSDSEDSWELDSSLE
HCLGMPAAYSSTPPACEKELGELHSREKDSSTKPQAGGSDQHDAGGNTTDSTSEASDSAN
TESRGFKTSGSSDSMDALEEDELEACSSSRPEFFHFYTPTVHEMNNSEGSSRAKDRDFFC
FLQVPEAEEHGREHSPWEERGVDIGVSMLGSKLSERNAMGYYSLCCSVSPAGSVEKSNIS
HSPGRRPWKDVSAQEEAHCGAEQVAEASDLNLILEPPPGFGDTSSEEEFYDAADSLSPPD
TLAGKPVPTPLQAESLVMEKVTSSRNRILGENLMTRQTAREKNGKEKQLTYAKSLRKRRS
FLKTNYTSQVTFPLALPDSLQSYCTWPPTPPLLAQPPDPPSPENFEKDAESGLPAATQAQ
RDTASTNPSSDMMEMEPDTMETKSVTDLVVSSISAVRLQGEQSRVVRGSPTMEVNTGWPS
DESCVSIGDWLAQAALGGEGEMMEVKHEAGNVPLFQVREVTCPADECTLPSSCCVASMAI
PHGVTQDQDLLPAAGEQAAWEKPVLAPCEEGKANLDSCADCESDHASLQAKTRQEINKEA
LQKVHSKSHMGFPDATQLLTDCSSTSGVITRLSWLSFGARSDLTSPSPSQKRTDAPLELL
DSQRTSRCLEVDVVRKEMQISSATLPFEKELKSRHGLDEGVSRKDTENVAHEQTWSVQIS
PREQVTEVEKDSPLTPSQGLSISSGVIPLGSLEKRAGDHRTSNYSFLCFNQKKDEQALSG
PIMTRFWGFSMMKTSPPQFGMDKCSCQLSYVSCFHRPDEEGEQETTIPMCSLFLQPLTTP
PSTNRSLPGSSVDSYPVTIARDKAVWDPHVQALSQLNDQAQMSPADFSCFLAYTTELKEV
VGNLSGNQATHLQDRCAEQGAESKGALGLASQDLLSSCKELLKIERPLEELQDALRVTFG
HLVQLAVACFQVTHCQLCRQRQQELRAALVDVVGTYHQFVQAVHQQLHRQGCPDLGTKLL
TRQHTALTAAMFCLMQQFRVPPLF
Download sequence
Identical sequences U3J3P0
ENSAPLP00000014117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]