SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014133 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014133
Domain Number 1 Region: 183-317
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-31
Family Third domain of FERM 0.0053
Further Details:      
 
Domain Number 2 Region: 71-176
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-31
Family Second domain of FERM 0.0000661
Further Details:      
 
Domain Number 3 Region: 4-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-19
Family First domain of FERM 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014133   Gene: ENSAPLG00000014312   Transcript: ENSAPLT00000014907
Sequence length 550
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742573.1:341940:425694:-1 gene:ENSAPLG00000014312 transcript:ENSAPLT00000014907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLFLQRETKGQFLIDHICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKLXXXXT
MCFRVKFYPHEPLKIKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAELGDYD
PDEHPENYISDFKIFPKQSQKLEKKIAEIHKNECRGQSPAVAEFNLLLKAHSLETFVCSX
XSKDSTGTTTFLGFTAAGFVVFQGNKRIHLLKWCDVYKLKFEGKTFYVFGAQKEKKAVLT
FHTSTPAACKHLWKCGVENQAFYKYAKSSQIKTMSSSKIFFKGSRFRYSGKVAKEVVEAS
SKIQREPPEVHRTSITQSRSSPSLNKQLIINMEPLQPLLPSPCEEEEVPLDEGIQLPKED
DVSVPVISSSPVKDTGENVDLANNQEEKMKEEPLTISELVYNPSASLLPTPVDDEIDMLF
DSCPRAENEKDDTDSFEELDADENAFMIAEEEELKEARRALRWSYDFLMGNIEVNAFVKS
FSRLLLVGLGLLLFVFPLLLVLLESDLQISFLHEIRETPEFQQFHIEYYCPLRQWVACKI
NFIRDMLGSF
Download sequence
Identical sequences U3J3Q6
ENSAPLP00000014133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]