SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014147 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014147
Domain Number 1 Region: 13-383
Classification Level Classification E-value
Superfamily Cullin repeat-like 9.94e-100
Family Cullin repeat 0.00000242
Further Details:      
 
Domain Number 2 Region: 395-659
Classification Level Classification E-value
Superfamily Cullin homology domain 7.06e-90
Family Cullin homology domain 0.000000446
Further Details:      
 
Domain Number 3 Region: 662-750
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.99e-28
Family SCF ubiquitin ligase complex WHB domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014147   Gene: ENSAPLG00000014251   Transcript: ENSAPLT00000014921
Sequence length 750
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742539.1:2267987:2311340:1 gene:ENSAPLG00000014251 transcript:ENSAPLT00000014921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPTMSLKPRVVDFDETWNKLLTTIKAVVMLDYVERATWNDRFSDIYALCVAYPEPLGERL
YTETKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNK
LTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMIEPLQAILIRMLLREIKNDRCGEDPN
QKVIHGVINSFVHVEQYKKKFPLKFYQEIFECPFLNETGEYYKQEASNLLQESNCSQYME
KVLGRLKDEEMRCRKYLHPSSYGKVIHECQQRMVADHLQFLHAECHNIIRQEKRSDMANM
YTLLRAVSSGLPHMIQELQNHIHDEGLRATSNLSQENMPTQFVESVLEVHSKFVQLINTV
LNGDQHFMSALDKALTSVVNYREPKSICKAPELLELAKYCDNLLKKSAKGMTENEVEDKL
TSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHR
MYTDMSVSADLNNKFNNFIKNQDTIIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEK
SVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLCKPYVAMVTTYQMAVLLAFNNSETVS
YKELQDSTQMNEKELTKTIKSLLDVKMINHDSDKEDVEAESTFSLNMNFSSKRTKFKITT
SMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSI
SMIKKCIEVLIDKQYIERSQASADEYSYVA
Download sequence
Identical sequences U3J3S0
ENSAPLP00000014147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]