SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014156 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014156
Domain Number 1 Region: 122-217
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.17e-40
Family Forkhead DNA-binding domain 0.0000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014156   Gene: ENSAPLG00000014329   Transcript: ENSAPLT00000014930
Sequence length 388
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743395.1:941269:942882:-1 gene:ENSAPLG00000014329 transcript:ENSAPLT00000014930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQSYSSVSNMNAGLGMNSMNTYMTMSAMSTTANAATTMNMSYANTGMSPSLTGMSPGAGA
MPGVAGMGAHLSPSMSPMGGQAGSMNALAPYTNMNSMSPIYGQSNLNRSRDPKTYRRSYT
HAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDC
FLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCAGRQGQRWGGWRGRWRGQE
GARAATXSEGSAGAESPASASPCQDHKRALADLKGTAGLSPGEPAASPAQHLLAPPHAGL
PHDAHLKPEHHYAFNHPFSINNLMSSSEQQMDLKAYEQVMHYSGYASPMPGSLAMGPVTN
KNGLESSPLAGETSYYQGVYSRPIMNSS
Download sequence
Identical sequences U3J3S9
ENSAPLP00000014156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]